TF Information

ENSSHAG00000002042 *(Sarcophilus harrisii)* SAND
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF01342 (SAND)	IPR000770	ENSSHAG00000002042	T321905_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DEAF1 M11266_2.00	Pan troglodytes	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$DEAF1_01	0.992	0.961
DEAF1 M11267_2.00	Pan troglodytes	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$DEAF1_02	0.992	0.961
For this family, TFs with SR scores > 0.843* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSSHAP00000002302	SAND	107	182	SAYDSELPVRCRNLSGTLHKNRLGSGGRGRCIKQGENWYSPTEFEAMAGRASSKDWKRSIRYAGRPLQCLIQDGIL

Links
Other SAND family TFs
Other *Sarcophilus harrisii* TFs

Invalid Input OrderBy

92 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action