TF Information

SINV20880 *(Solenopsis invicta)* SAND
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF01342 (SAND)	IPR000770	SINV20880	T322084_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DEAF1 M11266_2.00	Pan troglodytes	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$DEAF1_01	0.870	0.632
DEAF1 M11267_2.00	Pan troglodytes	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$DEAF1_02	0.870	0.632
For this family, TFs with SR scores > 0.843* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
SINV20880-PA	SAND	174	249	SANLAVLPIRCKNTNAELHKSRFGSGGRGRCIKLGSDWYTPSEFEALCGRASSKDWKRSIRFGGRSLQTLIDEQIL

Links
Other SAND family TFs
Other *Solenopsis invicta* TFs

Invalid Input OrderBy

106 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action