TF Information

POPTR_0015s07140 *(Populus trichocarpa)* SBP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03110 (SBP)	IPR004333	POPTR_0015s07140	T322966_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
SPL13A M07265_2.00	Arabidopsis thaliana	DNYGTACGGWH	DWCCGTACRNH	Dap-seq OMalley et al.(2016) SPL13_col_a	0.948	0.707
estExt_fgenesh1_pg.C_1940033 M02479_2.00	Physcomitrella patens	NNGTACGDH	DHCGTACNN	PBM Weirauch et al.(2014) pTH8664	0.896	0.760
SPL14 M02470_2.00	Arabidopsis thaliana	NNNRTACNN	NNGTAYNNN	PBM Weirauch et al.(2014) pTH8191	0.894	0.707
SPL14 M07253_2.00	Arabidopsis thaliana	NNNBGTACGGW	WCCGTACVNNN	Dap-seq OMalley et al.(2016) SPL14_col_a	0.894	0.707
SPL14 M11270_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SPL14_01	0.894	0.707
SPL4 M02472_2.00	Arabidopsis thaliana	NRTACDDNN	NNHHGTAYN	PBM Weirauch et al.(2014) pTH7408	0.891	0.653
fgenesh1_pg.scaffold_252000020 M02481_2.00	Physcomitrella patens	NNNKRCVNN	NNBGYMNNN	PBM Weirauch et al.(2014) pTH8491	0.891	0.693
POPTR_0002s00440 M02477_2.00	Populus trichocarpa	NGTACGG	CCGTACN	PBM Weirauch et al.(2014) pTH9280	0.891	0.680
fgenesh1_pg.scaffold_194000034 M02480_2.00	Physcomitrella patens	NNNGTACNNN	NNNGTACNNN	PBM Weirauch et al.(2014) pTH8580	0.887	0.707
For this family, TFs with SR scores > 0.885* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
POPTR_0015s07140.1	SBP	176	250	CQVYDCNKDLSSSKEYHKRHKVCEVHSRTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKP

Links
Other SBP family TFs
Other *Populus trichocarpa* TFs

Invalid Input OrderBy

357 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action