TF Information

30190.m011329 *(Ricinus communis)* SBP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03110 (SBP)	IPR004333	30190.m011329	T323229_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
SPL3 M07255_2.00	Arabidopsis thaliana	NGTACGGA	TCCGTACN	Dap-seq OMalley et al.(2016) SPL3_col_a	0.890	0.773
SPL3 M07256_2.00	Arabidopsis thaliana	NDNTGTACGGAHN	NDTCCGTACANHN	Dap-seq OMalley et al.(2016) SPL3_colamp_a	0.890	0.773
SPL3 M02715_2.00	Arabidopsis thaliana	DDDDDNGTACGKHHHH	DDDDMCGTACNHHHHH	SELEX Mathelier et al.(2014) MA0577.1	0.890	0.773
For this family, TFs with SR scores > 0.885* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
30190.m011329	SBP	57	131	CQAENCTFDMTEAKRYHRRHKVCEHHAKAPCVLVSGIHQRFCQQCSRFHEVSEFDDTKRSCRRRLAGHNERRRKS

Links
Other SBP family TFs
Other *Ricinus communis* TFs

Invalid Input OrderBy

163 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action