TF Information

Eucgr.K01828 *(Eucalyptus grandis)* SBP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03110 (SBP)	IPR004333	Eucgr.K01828	T323460_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
estExt_fgenesh1_pg.C_1940033 M02479_2.00	Physcomitrella patens	NNGTACGDH	DHCGTACNN	PBM Weirauch et al.(2014) pTH8664	0.915	0.747
SPL4 M02472_2.00	Arabidopsis thaliana	NRTACDDNN	NNHHGTAYN	PBM Weirauch et al.(2014) pTH7408	0.904	0.680
SPL14 M02470_2.00	Arabidopsis thaliana	NNNRTACNN	NNGTAYNNN	PBM Weirauch et al.(2014) pTH8191	0.896	0.680
POPTR_0002s00440 M02477_2.00	Populus trichocarpa	NGTACGG	CCGTACN	PBM Weirauch et al.(2014) pTH9280	0.896	0.680
SPL14 M07253_2.00	Arabidopsis thaliana	NNNBGTACGGW	WCCGTACVNNN	Dap-seq OMalley et al.(2016) SPL14_col_a	0.896	0.680
SPL14 M11270_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SPL14_01	0.896	0.680
SPL12 M02475_2.00	Arabidopsis thaliana	NGTACGDN	NHCGTACN	PBM Weirauch et al.(2014) pTH7500	0.892	0.720
PK06791.1 M02482_2.00	Cannabis sativa	NNGTACGRN	NYCGTACNN	PBM Weirauch et al.(2014) pTH9583	0.890	0.680
For this family, TFs with SR scores > 0.885* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Eucgr.K01828.1	SBP	77	151	CQVEGCNVDLSEVKTYYLRHKVCGTHSKAATVVVRGLEQRFCQQCSRFHQLNEFDQGKRSCRRRLAGHNERRRKP

Links
Other SBP family TFs
Other *Eucalyptus grandis* TFs

Invalid Input OrderBy

303 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action