TF Information

Thhalv10018638m.g *(Eutrema salsugineum)* SBP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03110 (SBP)	IPR004333	Thhalv10018638m.g	T323693_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
estExt_fgenesh1_pg.C_1940033 M02479_2.00	Physcomitrella patens	NNGTACGDH	DHCGTACNN	PBM Weirauch et al.(2014) pTH8664	0.899	0.787
SPL5 M02474_2.00	Arabidopsis thaliana	NNGTACGDN	NHCGTACNN	PBM Weirauch et al.(2014) pTH7385	0.892	0.667
SPL5 M07261_2.00	Arabidopsis thaliana	NDNYGTACGGAH	DTCCGTACRNHN	Dap-seq OMalley et al.(2016) SPL5_col_a	0.892	0.667
SPL5 M07262_2.00	Arabidopsis thaliana	NBGTACGGWH	DWCCGTACVN	Dap-seq OMalley et al.(2016) SPL5_colamp_a	0.892	0.667
For this family, TFs with SR scores > 0.885* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10018638m	SBP	132	206	CQVYGCNMDLSFSKDYHKRHRVCETHSKTSVVIVSGIEQRFCQQCSRFHFLSEFDDGKRSCRRRLAGHNERRRKP

Links
Other SBP family TFs
Other *Eutrema salsugineum* TFs

Invalid Input OrderBy

253 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action