CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

SINV22770 *(Solenopsis invicta)* SMAD
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03165 (MH1)	IPR003619	SINV22770	T325194_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Smad3 M00192_2.00	Mus musculus	NNNNNMGMCN	NGKCKNNNNN	PBM Badis et al.(2009) Smad3_3805	0.780	0.780
SMAD3 M03482_2.00	Homo sapiens	YGTCTAGACA	TGTCTAGACR	SELEX Jolma et al.(2013) SMAD3_1	0.780	0.780
SMAD3 M09380_2.00	Homo sapiens	NBCTSHCWSCWB	VWGSWGDSAGVN	Misc Kulakovskiy et al.(2013) SMAD3_HUMAN.H11MO.0.B	0.780	0.780
Smad3 M09384_2.00	Mus musculus	NBCTSHCWSCWB	VWGSWGDSAGVN	Misc Kulakovskiy et al.(2013) SMAD3_MOUSE.H11MO.0.B	0.780	0.780
Smad3 M09637_2.00	Mus musculus	BYAGMCWN	NWGKCTRV	Misc Heinz et al.(2010) NPC-Smad3_GSE36673	0.780	0.780
SMAD3 M11283_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SMAD3_Q6_01	0.780	0.780
SMAD3 M11284_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SMAD3_Q6_02	0.780	0.780
SMAD3 M11285_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SMAD3_Q6	0.780	0.780
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
SINV22770-PA	SMAD	30	70	SEKAVKSLVKKLKKSAGLEELEKAITTQSCNTKCITIPRYV

Links
Other SMAD family TFs
Other *Solenopsis invicta* TFs