TF Information

Bcin11g04340 *(Botrytis cinerea)* Sox
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00505 (HMG_box)	IPR000910	Bcin11g04340	T326538_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
NHP6B M01565_2.00	Saccharomyces cerevisiae	NNWHWRYDNN	NNHRYWDWNN	PBM Zhu et al.(2009) Nhp6b	0.456	0.507
NHP6A M01566_2.00	Saccharomyces cerevisiae	NHRYWWWN	NWWWRYDN	PBM Zhu et al.(2009) Nhp6a	0.456	0.507
NHP6B M08603_2.00	Saccharomyces cerevisiae	HNTHHNWWTATAWWWWRNDN	NHNYWWWWTATAWWNDDAND	Misc DeBoer et al.(2011) YBR089C-A_792	0.456	0.507
NHP6A M08606_2.00	Saccharomyces cerevisiae	DNDHNNWTATATADWRDNNDN	NHNNHYWHTATATAWNNDHNH	Misc DeBoer et al.(2011) YPR052C_879	0.456	0.507
For this family, TFs with SR scores > 0.415* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bcin11g04340.1	Sox	155	223	PKRGISAYMFYANDQHDRVRQENPALSFGQLGILLGEEWRALSVGQRSVYEEMATKDLRRYEEELARYR

Links
Other Sox family TFs
Other *Botrytis cinerea* TFs

Invalid Input OrderBy

264 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action