TF Information

ENSMGAG00000006798 *(Meleagris gallopavo)* STAT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02864 (STAT_bind)	IPR013801	ENSMGAG00000006798	T337505_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Stat6 M08173_2.00	Mus musculus	NNBTTCYWVRGAANN	NNTTCYBWRGAAVNN	ChIP-seq Mathelier et al.(2014) MA0520.1	0.802	0.802
Stat6 M09418_2.00	Mus musculus	BDBTTCHBDRGAAV	BTTCYHVDGAAVHV	Misc Kulakovskiy et al.(2013) STAT6_MOUSE.H11MO.0.A	0.802	0.802
Stat6 M09644_2.00	Mus musculus	TTCCNNAGAA	TTCTNNGGAA	Misc Heinz et al.(2010) Macrophage-Stat6_GSE38377	0.802	0.802
Stat6 M09643_2.00	Mus musculus	NNTTCYNNRGAA	TTCYNNRGAANN	Misc Heinz et al.(2010) CD4-Stat6_GSE22104	0.802	0.802
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSMGAP00000006844	STAT	1	92	QERVPFVVAERVPWEKMCETLNLKFTAEVQTTKGLLKEHYFFLAQKIFNDHSATPEDFQSRSVSWAQFNKEILPGRGFTFWQWFDGVLDLTK

Links
Other STAT family TFs
Other *Meleagris gallopavo* TFs

Invalid Input OrderBy

34 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action