TF Information

Brh_R001450 *(Buceros rhinoceros)* STAT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF02864 (STAT_bind)	IPR013801	Brh_R001450	T337810_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Stat4 M08174_2.00	Mus musculus	NNNYTTCYYRGAAV	BTTCYRRGAARNNN	ChIP-seq Mathelier et al.(2014) MA0518.1	0.868	0.868
Stat4 M09424_2.00	Mus musculus	YTTCYHDKMA	TKMHDRGAAR	Misc Kulakovskiy et al.(2013) STAT4_MOUSE.H11MO.0.A	0.868	0.868
Stat4 M09646_2.00	Mus musculus	NYTTCCNGGAAR	YTTCCNGGAARN	Misc Heinz et al.(2010) CD4-Stat4_GSE22104	0.868	0.868
STAT4 M09413_2.00	Homo sapiens	YTTCYBDKMAN	NTKMHVRGAAR	Misc Kulakovskiy et al.(2013) STAT4_HUMAN.H11MO.0.A	0.859	0.859
STAT4 M11361_2.00	Homo sapiens	BNHTTCNN	NNGAADNV	Transfac Matys et al.(2006) V$STAT4_01	0.859	0.859
STAT4 M11362_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$STAT4_Q4	0.859	0.859
STAT4 M11363_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$STAT4_Q5	0.859	0.859
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Brh_R001450	STAT	316	563	FVVERQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQIRVKATIDKNVSTVSNRRFVLCGTHVKAMNMDESANGSLSVEFRHLQPKEMKSSAGSKGNEGPHMVTEELHSISFETQVCLYGLTINLETSSLPVVMISNVSQLPNAWASIIWYNLSTNDPQNLSFFNNPPAAPLNQLLEVLSWQFSSYVGRGLNSEQLNMLAEKLTGQQVGYNDYQLSWAKFCKEHLPGKSFTFWVWLEAILDLIK

Links
Other STAT family TFs
Other *Buceros rhinoceros* TFs

Invalid Input OrderBy

36 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action