TF Information

TCP11 *(Arabidopsis thaliana)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03634 (TCP)	IPR005333	AT2G37000	T343684_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: Encodes a transcriptional repressor that performs overlapping functions with LHY in a regulatory feedback loop that is closely associated with the circadian oscillator of Arabidopsis. Binds to the evening element in the promoter of TOC1 and represses TOC1 transcription. CCA1 and LHY colocalize in the nucleus and form heterodimers in vivo. CCA1 and LHY function synergistically in regulating circadian rhythms of Arabidopsis.
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TCP11 M11395_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP11_01	(Direct)	(Direct)
TCP11 M11396_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP11_02	(Direct)	(Direct)
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TCP14 M07289_2.00	Arabidopsis thaliana	AVADAKVDBGTGGGDCCCAC	GTGGGHCCCACVHBMTHTBT	Dap-seq OMalley et al.(2016) TCP14_col_b	0.905	0.408
PK12736.1 M01315_2.00	Cannabis sativa	NRRSCMYAYNNNNN	NNNNNRTRKGSYYN	PBM Lambert et al.(2019) pTH10121	0.897	0.430
PCF2 M11399_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PCF2_01	0.896	0.331
GLYMA19G26560 M02511_2.00	Glycine max	BGGBCCCAC	GTGGGVCCV	PBM Weirauch et al.(2014) pTH9184	0.895	0.401
PK13314.1 M01316_2.00	Cannabis sativa	NNGGNCCCAC	GTGGGNCCNN	PBM Lambert et al.(2019) pTH11330	0.893	0.387
TCP15 M00892_2.00	Arabidopsis thaliana	NNGGNCCCAC	GTGGGNCCNN	PBM Franco-Zorrilla et al.(2014) TCP15	0.893	0.380
TCP15 M07277_2.00	Arabidopsis thaliana	RTRGGDCCCACHH	DDGTGGGHCCYAY	Dap-seq OMalley et al.(2016) At1g69690_col_a	0.893	0.380
TCP15 M07278_2.00	Arabidopsis thaliana	RTRGGNCCCACHW	WDGTGGGNCCYAY	Dap-seq OMalley et al.(2016) At1g69690_colamp_a	0.893	0.380
TCP15 M11394_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP15_01	0.893	0.380
TCP9 M01086_2.00	Arabidopsis thaliana	NNGGGCCCACN	NGTGGGCCCNN	PBM Sullivan et al.(2014) pTH9796	0.889	0.366
TCP9 M07281_2.00	Arabidopsis thaliana	RTGGGDCCCAC	GTGGGHCCCAY	Dap-seq OMalley et al.(2016) At2g45680_colamp_a	0.889	0.366
TCP9 M07282_2.00	Arabidopsis thaliana	DGTGGGRCCCACDDNDNDNBN	NVNHNHNHHGTGGGYCCCACH	Dap-seq OMalley et al.(2016) At2g45680_col_b	0.889	0.366
VIT_15s0048g01150 M02515_2.00	Vitis vinifera	NNGGNCCCAC	GTGGGNCCNN	PBM Weirauch et al.(2014) pTH9294	0.889	0.345
TCP8 M01311_2.00	Arabidopsis thaliana	NGGNMCCAC	GTGGKNCCN	PBM Lambert et al.(2019) pTH11569	0.886	0.387
AT-TCP20 M02507_2.00	Arabidopsis lyrata	GRSCCCAC	GTGGGSYC	PBM Weirauch et al.(2014) pTH9229	0.885	0.359
TCP20 M02502_2.00	Arabidopsis thaliana	GGSCCCACNN	NNGTGGGSCC	PBM Weirauch et al.(2014) pTH8159	0.884	0.352
TCP20 M07285_2.00	Arabidopsis thaliana	NNNNNNNNNNGTGGGRCCCAC	GTGGGYCCCACNNNNNNNNNN	Dap-seq OMalley et al.(2016) TCP20_col_a	0.884	0.352
TCP20 M07286_2.00	Arabidopsis thaliana	RTGGGDCCCACH	DGTGGGHCCCAY	Dap-seq OMalley et al.(2016) TCP20_colamp_a	0.884	0.352
TCP20 M11397_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP20_01	0.884	0.352
PK14653.1 M01317_2.00	Cannabis sativa	BGGSCCCAC	GTGGGSCCV	PBM Lambert et al.(2019) pTH11324	0.882	0.352
PK14653.1 M02517_2.00	Cannabis sativa	BTGGGCCCAV	BTGGGCCCAV	PBM Weirauch et al.(2014) pTH9586	0.882	0.352
LjSGA_053525.1 M02518_2.00	Lotus japonicus	GGNCCCAC	GTGGGNCC	PBM Weirauch et al.(2014) pTH9201	0.880	0.331
TCP23 M00891_2.00	Arabidopsis thaliana	NNGGKCCCAC	GTGGGMCCNN	PBM Franco-Zorrilla et al.(2014) TCP23	0.879	0.359
cassava45561.m1 M02516_2.00	Manihot esculenta	KGGVCCCACH	DGTGGGBCCM	PBM Weirauch et al.(2014) pTH9207	0.878	0.359
TCP22 M07279_2.00	Arabidopsis thaliana	RTRGGNCCCACHN	NDGTGGGNCCYAY	Dap-seq OMalley et al.(2016) At1g72010_colamp_a	0.876	0.352
TCP22 M07280_2.00	Arabidopsis thaliana	RTGGGDCCCACNN	NNGTGGGHCCCAY	Dap-seq OMalley et al.(2016) At1g72010_col	0.876	0.352
TCP21 M07292_2.00	Arabidopsis thaliana	NNRTGGGDCCCACN	NGTGGGHCCCAYNN	Dap-seq OMalley et al.(2016) At5g08330_col_a	0.869	0.359
TCP21 M07293_2.00	Arabidopsis thaliana	RTRGGDCCCACH	DGTGGGHCCYAY	Dap-seq OMalley et al.(2016) At5g08330_colamp_a	0.869	0.359
OS02G0635800 M02512_2.00	Oryza sativa	NBGGGCCCVN	NBGGGCCCVN	PBM Weirauch et al.(2014) pTH8856	0.863	0.366
OsI_08196 M02513_2.00	Oryza sativa	GGGCCCAC	GTGGGCCC	PBM Weirauch et al.(2014) pTH9274	0.862	0.352
fgenesh2_kg.8__1074__AT5G51910.2 M02509_2.00	Arabidopsis lyrata	GRSCCCAC	GTGGGSYC	PBM Weirauch et al.(2014) pTH9232	0.860	0.317
TCP19 M02504_2.00	Arabidopsis thaliana	NNGGVCCCAC	GTGGGBCCNN	PBM Weirauch et al.(2014) pTH7452	0.860	0.310
TCP7 M07294_2.00	Arabidopsis thaliana	RTGGGNCCCAC	GTGGGNCCCAY	Dap-seq OMalley et al.(2016) TCP7_col_a	0.858	0.345
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AT2G37000.1	TCP	41	188	ARTKDRHTKVNGRSRRVTMPALAAARIFQLTRELGHKTEGETIEWLLSQAEPSIIAATGYGTKLISNWVDVAADDSSSSSSMTSPQTQTQTPQSPSCRLDLCQPIGIQYPVNGYSHMPFTAMLLEPMTTTAESEVEIAEEEERRRRHH

Links
Other TCP family TFs
Other *Arabidopsis thaliana* TFs

Invalid Input OrderBy

618 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

TCP11 (Arabidopsis thaliana) TCP

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

618 Related TFs

Invalid Input OrderBy

TCP11 **(Arabidopsis thaliana)
TCP**