TF Information

TCP19 *(Arabidopsis thaliana)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03634 (TCP)	IPR005333	AT5G51910	T343697_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: Similar to a putative transcription factor and transcriptional coactivators. Repressor of GA responses and involved in gibberellic acid mediated signaling. Member of the DELLA proteins that restrain the cell proliferation and expansion that drives plant growth. The protein undergoes degradation in response to GA via the 26S proteasome. GAI may be involved in reducing ROS accumulation in response to stress by up-regulating the transcription of superoxide dismutases. Represses GA-induced vegetative growth and floral initiation. Rapidly degraded in response to GA.
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TCP19 M02504_2.00	Arabidopsis thaliana	NNGGVCCCAC	GTGGGBCCNN	PBM Weirauch et al.(2014) pTH7452	(Direct)	(Direct)
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
LjSGA_053525.1 M02518_2.00	Lotus japonicus	GGNCCCAC	GTGGGNCC	PBM Weirauch et al.(2014) pTH9201	0.970	0.843
PCF2 M11399_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PCF2_01	0.969	0.783
fgenesh2_kg.8__1074__AT5G51910.2 M02509_2.00	Arabidopsis lyrata	GRSCCCAC	GTGGGSYC	PBM Weirauch et al.(2014) pTH9232	0.967	0.940
VIT_15s0048g01150 M02515_2.00	Vitis vinifera	NNGGNCCCAC	GTGGGNCCNN	PBM Weirauch et al.(2014) pTH9294	0.962	0.855
TCP20 M02502_2.00	Arabidopsis thaliana	GGSCCCACNN	NNGTGGGSCC	PBM Weirauch et al.(2014) pTH8159	0.961	0.651
TCP20 M07285_2.00	Arabidopsis thaliana	NNNNNNNNNNGTGGGRCCCAC	GTGGGYCCCACNNNNNNNNNN	Dap-seq OMalley et al.(2016) TCP20_col_a	0.961	0.651
TCP20 M07286_2.00	Arabidopsis thaliana	RTGGGDCCCACH	DGTGGGHCCCAY	Dap-seq OMalley et al.(2016) TCP20_colamp_a	0.961	0.651
TCP20 M11397_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP20_01	0.961	0.651
PK14653.1 M01317_2.00	Cannabis sativa	BGGSCCCAC	GTGGGSCCV	PBM Lambert et al.(2019) pTH11324	0.959	0.855
PK14653.1 M02517_2.00	Cannabis sativa	BTGGGCCCAV	BTGGGCCCAV	PBM Weirauch et al.(2014) pTH9586	0.959	0.855
AT-TCP20 M02507_2.00	Arabidopsis lyrata	GRSCCCAC	GTGGGSYC	PBM Weirauch et al.(2014) pTH9229	0.959	0.651
TCP9 M01086_2.00	Arabidopsis thaliana	NNGGGCCCACN	NGTGGGCCCNN	PBM Sullivan et al.(2014) pTH9796	0.958	0.843
TCP9 M07281_2.00	Arabidopsis thaliana	RTGGGDCCCAC	GTGGGHCCCAY	Dap-seq OMalley et al.(2016) At2g45680_colamp_a	0.958	0.843
TCP9 M07282_2.00	Arabidopsis thaliana	DGTGGGRCCCACDDNDNDNBN	NVNHNHNHHGTGGGYCCCACH	Dap-seq OMalley et al.(2016) At2g45680_col_b	0.958	0.843
TCP15 M00892_2.00	Arabidopsis thaliana	NNGGNCCCAC	GTGGGNCCNN	PBM Franco-Zorrilla et al.(2014) TCP15	0.956	0.723
TCP15 M07277_2.00	Arabidopsis thaliana	RTRGGDCCCACHH	DDGTGGGHCCYAY	Dap-seq OMalley et al.(2016) At1g69690_col_a	0.956	0.723
TCP15 M07278_2.00	Arabidopsis thaliana	RTRGGNCCCACHW	WDGTGGGNCCYAY	Dap-seq OMalley et al.(2016) At1g69690_colamp_a	0.956	0.723
TCP15 M11394_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP15_01	0.956	0.723
PK12736.1 M01315_2.00	Cannabis sativa	NRRSCMYAYNNNNN	NNNNNRTRKGSYYN	PBM Lambert et al.(2019) pTH10121	0.952	0.711
TCP14 M07289_2.00	Arabidopsis thaliana	AVADAKVDBGTGGGDCCCAC	GTGGGHCCCACVHBMTHTBT	Dap-seq OMalley et al.(2016) TCP14_col_b	0.952	0.699
GLYMA19G26560 M02511_2.00	Glycine max	BGGBCCCAC	GTGGGVCCV	PBM Weirauch et al.(2014) pTH9184	0.949	0.699
PK13314.1 M01316_2.00	Cannabis sativa	NNGGNCCCAC	GTGGGNCCNN	PBM Lambert et al.(2019) pTH11330	0.948	0.675
TCP22 M07279_2.00	Arabidopsis thaliana	RTRGGNCCCACHN	NDGTGGGNCCYAY	Dap-seq OMalley et al.(2016) At1g72010_colamp_a	0.947	0.687
TCP22 M07280_2.00	Arabidopsis thaliana	RTGGGDCCCACNN	NNGTGGGHCCCAY	Dap-seq OMalley et al.(2016) At1g72010_col	0.947	0.687
TCP23 M00891_2.00	Arabidopsis thaliana	NNGGKCCCAC	GTGGGMCCNN	PBM Franco-Zorrilla et al.(2014) TCP23	0.944	0.699
TCP8 M01311_2.00	Arabidopsis thaliana	NGGNMCCAC	GTGGKNCCN	PBM Lambert et al.(2019) pTH11569	0.942	0.675
cassava45561.m1 M02516_2.00	Manihot esculenta	KGGVCCCACH	DGTGGGBCCM	PBM Weirauch et al.(2014) pTH9207	0.942	0.639
TCP21 M07292_2.00	Arabidopsis thaliana	NNRTGGGDCCCACN	NGTGGGHCCCAYNN	Dap-seq OMalley et al.(2016) At5g08330_col_a	0.940	0.651
TCP21 M07293_2.00	Arabidopsis thaliana	RTRGGDCCCACH	DGTGGGHCCYAY	Dap-seq OMalley et al.(2016) At5g08330_colamp_a	0.940	0.651
TCP7 M07294_2.00	Arabidopsis thaliana	RTGGGNCCCAC	GTGGGNCCCAY	Dap-seq OMalley et al.(2016) TCP7_col_a	0.938	0.651
OsI_08196 M02513_2.00	Oryza sativa	GGGCCCAC	GTGGGCCC	PBM Weirauch et al.(2014) pTH9274	0.931	0.614
OS02G0635800 M02512_2.00	Oryza sativa	NBGGGCCCVN	NBGGGCCCVN	PBM Weirauch et al.(2014) pTH8856	0.930	0.602
TCP11 M11395_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP11_01	0.860	0.530
TCP11 M11396_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP11_02	0.860	0.530
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

Experimental Constructs

Motif ID	Domain	From	To	Sequence
M02504_2.00	TCP	55	180	PTSKDRHTKVEGRGRRIRMPAGCAARVFQLTRELGHKSDGETIRWLLERAEPAIIEATGTGTVPAIAVSVNGTLKIPTSSPVLNDGGRDGDGDLIKKRRKRNCTSDFVDVNDSCHSSVTSGLAPIT

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AT5G51910.1	TCP	55	180	PTSKDRHTKVEGRGRRIRMPAGCAARVFQLTRELGHKSDGETIRWLLERAEPAIIEATGTGTVPAIAVSVNGTLKIPTSSPVLNDGGRDGDGDLIKKRRKRNCTSDFVDVNDSCHSSVTSGLAPIT
AT5G51910.2	TCP	55	180	PTSKDRHTKVEGRGRRIRMPAGCAARVFQLTRELGHKSDGETIRWLLERAEPAIIEATGTGTVPAIAVSVNGTLKIPTSSPVLNDGGRDGDGDLIKKRRKRNCTSDFVDVNDSCHSSVTSGLAPIT

Links
Other TCP family TFs
Other *Arabidopsis thaliana* TFs

Invalid Input OrderBy

660 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

TCP19 (Arabidopsis thaliana) TCP

TF Information

Directly determined binding motifs

Motifs from related TFs

Experimental Constructs

DNA Binding Domains

Links

660 Related TFs

Invalid Input OrderBy

TCP19 **(Arabidopsis thaliana)
TCP**