TF Information

GRMZM2G148022 *(Zea mays)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03634 (TCP)	IPR005333	GRMZM2G148022	T343933_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
OS01G0213800 M11398_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PCF5_01	0.914	0.473
TCP4 M02501_2.00	Arabidopsis thaliana	GGGACCAC	GTGGTCCC	PBM Weirauch et al.(2014) pTH8084	0.893	0.458
TCP3 M02500_2.00	Arabidopsis thaliana	NDGGMCCACN	NGTGGKCCHN	PBM Weirauch et al.(2014) pTH8835	0.892	0.443
TCP3 M07274_2.00	Arabidopsis thaliana	DHNGGGACCACH	DGTGGTCCCNDH	Dap-seq OMalley et al.(2016) TCP3_colamp_a	0.892	0.443
TCP3 M07275_2.00	Arabidopsis thaliana	DNBGGGACCACHN	NDGTGGTCCCVNH	Dap-seq OMalley et al.(2016) TCP3_col	0.892	0.443
TCP4 M02514_2.00	Arabidopsis lyrata	BKGGGACCAC	GTGGTCCCMV	PBM Weirauch et al.(2014) pTH9313	0.889	0.450
TCP13 M07283_2.00	Arabidopsis thaliana	GTGGGGACCACWD	HWGTGGTCCCCAC	Dap-seq OMalley et al.(2016) PTF1_col_a	0.868	0.374
TCP13 M07284_2.00	Arabidopsis thaliana	NNBGGGACCACHN	NDGTGGTCCCVNN	Dap-seq OMalley et al.(2016) PTF1_colamp_a	0.868	0.374
PK10344.1 M01313_2.00	Cannabis sativa	GGGACCAC	GTGGTCCC	PBM Lambert et al.(2019) pTH11464	0.858	0.374
LjT20A21.20.nc M02519_2.00	Lotus japonicus	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH9202	0.849	0.382
TCP17 M07290_2.00	Arabidopsis thaliana	GTGGGGACCAC	GTGGTCCCCAC	Dap-seq OMalley et al.(2016) TCP17_col_a	0.824	0.313
TCP17 M07291_2.00	Arabidopsis thaliana	RTGGGGACCAC	GTGGTCCCCAY	Dap-seq OMalley et al.(2016) TCP17_colamp_a	0.824	0.313
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GRMZM2G148022_P02	TCP	443	639	AGRKDRHSKVCTARGLRDRRVRLAAHTAIRFYDVQDRLGYDRPSKAVDWLIRNAKAAIDELSADREEGQPAAEAADATTTEPAEQVTSTSYGFAIGGVAGSFMPHSVGADDVSGSGSGSGSGNVKSLFPSSSTTSTTPTQDEYRGSPPDLLSRTTSSNQPQELCLTLQSTNNHHHQQQQQQQIFSHVSPNHHGSMIS

Links
Other TCP family TFs
Other *Zea mays* TFs

Invalid Input OrderBy

339 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

GRMZM2G148022 (Zea mays) TCP

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

339 Related TFs

Invalid Input OrderBy

GRMZM2G148022 **(Zea mays)
TCP**