TF Information

MTR_2g090960 *(Medicago truncatula)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03634 (TCP)	IPR005333	MTR_2g090960	T344038_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TCP4 M02514_2.00	Arabidopsis lyrata	BKGGGACCAC	GTGGTCCCMV	PBM Weirauch et al.(2014) pTH9313	0.951	0.578
TCP3 M02500_2.00	Arabidopsis thaliana	NDGGMCCACN	NGTGGKCCHN	PBM Weirauch et al.(2014) pTH8835	0.951	0.552
TCP3 M07274_2.00	Arabidopsis thaliana	DHNGGGACCACH	DGTGGTCCCNDH	Dap-seq OMalley et al.(2016) TCP3_colamp_a	0.951	0.552
TCP3 M07275_2.00	Arabidopsis thaliana	DNBGGGACCACHN	NDGTGGTCCCVNH	Dap-seq OMalley et al.(2016) TCP3_col	0.951	0.552
TCP4 M02501_2.00	Arabidopsis thaliana	GGGACCAC	GTGGTCCC	PBM Weirauch et al.(2014) pTH8084	0.948	0.569
OS01G0213800 M11398_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PCF5_01	0.943	0.560
LjT20A21.20.nc M02519_2.00	Lotus japonicus	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH9202	0.905	0.474
TCP2 M02508_2.00	Arabidopsis lyrata	GGSMCCAC	GTGGKSCC	PBM Weirauch et al.(2014) pTH9231	0.894	0.431
TCP2 M02503_2.00	Arabidopsis thaliana	NBGGKMCCVN	NBGGKMCCVN	PBM Weirauch et al.(2014) pTH8198	0.886	0.422
PK10344.1 M01313_2.00	Cannabis sativa	GGGACCAC	GTGGTCCC	PBM Lambert et al.(2019) pTH11464	0.864	0.405
TCP5 M02510_2.00	Arabidopsis lyrata	GGGACCAC	GTGGTCCC	PBM Weirauch et al.(2014) pTH9233	0.851	0.397
TCP13 M07283_2.00	Arabidopsis thaliana	GTGGGGACCACWD	HWGTGGTCCCCAC	Dap-seq OMalley et al.(2016) PTF1_col_a	0.850	0.414
TCP13 M07284_2.00	Arabidopsis thaliana	NNBGGGACCACHN	NDGTGGTCCCVNN	Dap-seq OMalley et al.(2016) PTF1_colamp_a	0.850	0.414
TCP5 M02505_2.00	Arabidopsis thaliana	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH7523	0.840	0.353
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
KEH39232	TCP	22	201	TGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLGYDRPSKAVDWLIKKAKSAIDKLDQLPPWNPIPNATEELQEEENNNNNAVETNEMVIAAEQSESSGYNLQQNNHHNHNHSGFIQSTIDNDAIAFFPTTSVGESMNFQSYSSDIISRTNNSTQDLGLSLHSFQDNSASNDQTL

Links
Other TCP family TFs
Other *Medicago truncatula* TFs

Invalid Input OrderBy

423 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

MTR_2g090960 (Medicago truncatula) TCP

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

423 Related TFs

Invalid Input OrderBy

MTR_2g090960 **(Medicago truncatula)
TCP**