TF Information

Pm024934 *(Prunus mume)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03634 (TCP)	IPR005333	Pm024934	T344564_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TCP22 M07279_2.00	Arabidopsis thaliana	RTRGGNCCCACHN	NDGTGGGNCCYAY	Dap-seq OMalley et al.(2016) At1g72010_colamp_a	0.842	0.300
TCP22 M07280_2.00	Arabidopsis thaliana	RTGGGDCCCACNN	NNGTGGGHCCCAY	Dap-seq OMalley et al.(2016) At1g72010_col	0.842	0.300
PK12736.1 M01315_2.00	Cannabis sativa	NRRSCMYAYNNNNN	NNNNNRTRKGSYYN	PBM Lambert et al.(2019) pTH10121	0.841	0.315
TCP8 M01311_2.00	Arabidopsis thaliana	NGGNMCCAC	GTGGKNCCN	PBM Lambert et al.(2019) pTH11569	0.837	0.315
TCP14 M07289_2.00	Arabidopsis thaliana	AVADAKVDBGTGGGDCCCAC	GTGGGHCCCACVHBMTHTBT	Dap-seq OMalley et al.(2016) TCP14_col_b	0.833	0.308
TCP15 M00892_2.00	Arabidopsis thaliana	NNGGNCCCAC	GTGGGNCCNN	PBM Franco-Zorrilla et al.(2014) TCP15	0.830	0.323
TCP15 M07277_2.00	Arabidopsis thaliana	RTRGGDCCCACHH	DDGTGGGHCCYAY	Dap-seq OMalley et al.(2016) At1g69690_col_a	0.830	0.323
TCP15 M07278_2.00	Arabidopsis thaliana	RTRGGNCCCACHW	WDGTGGGNCCYAY	Dap-seq OMalley et al.(2016) At1g69690_colamp_a	0.830	0.323
TCP15 M11394_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP15_01	0.830	0.323
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pm024934	TCP	92	225	TSTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHNSGSSMSVPSQLRSSYYSPNFSVHQNQRRSLFQGIGLSSSDSSSTLLNFQTNSMHASMLQAKQELRDTVSLDLSETASGEGSMGGRKRRPPEQDLNQM

Links
Other TCP family TFs
Other *Prunus mume* TFs

Invalid Input OrderBy

164 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action