TF Information

Cucsa.385930 *(Cucumis sativus)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03634 (TCP)	IPR005333	Cucsa.385930	T344654_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TCP21 M07292_2.00	Arabidopsis thaliana	NNRTGGGDCCCACN	NGTGGGHCCCAYNN	Dap-seq OMalley et al.(2016) At5g08330_col_a	0.843	0.475
TCP21 M07293_2.00	Arabidopsis thaliana	RTRGGDCCCACH	DGTGGGHCCYAY	Dap-seq OMalley et al.(2016) At5g08330_colamp_a	0.843	0.475
OsI_08196 M02513_2.00	Oryza sativa	GGGCCCAC	GTGGGCCC	PBM Weirauch et al.(2014) pTH9274	0.842	0.446
TCP22 M07279_2.00	Arabidopsis thaliana	RTRGGNCCCACHN	NDGTGGGNCCYAY	Dap-seq OMalley et al.(2016) At1g72010_colamp_a	0.842	0.446
TCP22 M07280_2.00	Arabidopsis thaliana	RTGGGDCCCACNN	NNGTGGGHCCCAY	Dap-seq OMalley et al.(2016) At1g72010_col	0.842	0.446
OS02G0635800 M02512_2.00	Oryza sativa	NBGGGCCCVN	NBGGGCCCVN	PBM Weirauch et al.(2014) pTH8856	0.841	0.465
TCP23 M00891_2.00	Arabidopsis thaliana	NNGGKCCCAC	GTGGGMCCNN	PBM Franco-Zorrilla et al.(2014) TCP23	0.838	0.475
TCP14 M07289_2.00	Arabidopsis thaliana	AVADAKVDBGTGGGDCCCAC	GTGGGHCCCACVHBMTHTBT	Dap-seq OMalley et al.(2016) TCP14_col_b	0.836	0.475
TCP7 M07294_2.00	Arabidopsis thaliana	RTGGGNCCCAC	GTGGGNCCCAY	Dap-seq OMalley et al.(2016) TCP7_col_a	0.835	0.465
PK12736.1 M01315_2.00	Cannabis sativa	NRRSCMYAYNNNNN	NNNNNRTRKGSYYN	PBM Lambert et al.(2019) pTH10121	0.829	0.455
TCP8 M01311_2.00	Arabidopsis thaliana	NGGNMCCAC	GTGGKNCCN	PBM Lambert et al.(2019) pTH11569	0.827	0.455
TCP15 M00892_2.00	Arabidopsis thaliana	NNGGNCCCAC	GTGGGNCCNN	PBM Franco-Zorrilla et al.(2014) TCP15	0.827	0.436
TCP15 M07277_2.00	Arabidopsis thaliana	RTRGGDCCCACHH	DDGTGGGHCCYAY	Dap-seq OMalley et al.(2016) At1g69690_col_a	0.827	0.436
TCP15 M07278_2.00	Arabidopsis thaliana	RTRGGNCCCACHW	WDGTGGGNCCYAY	Dap-seq OMalley et al.(2016) At1g69690_colamp_a	0.827	0.436
TCP15 M11394_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP15_01	0.827	0.436
TCP19 M02504_2.00	Arabidopsis thaliana	NNGGVCCCAC	GTGGGBCCNN	PBM Weirauch et al.(2014) pTH7452	0.824	0.406
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cucsa.385930.1	TCP	31	131	KAPKDRHAKVHGRDRRIRLPPLCAARVFQLTRELGNKTDGQTVEWLLKKAEPSIIALTGKNIASATLDLPGCSKPCDPSSSNTNSTTTSYFEEETLGGNNY

Links
Other TCP family TFs
Other *Cucumis sativus* TFs

Invalid Input OrderBy

372 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Cucsa.385930 (Cucumis sativus) TCP

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

372 Related TFs

Invalid Input OrderBy

Cucsa.385930 **(Cucumis sativus)
TCP**