TF Information

Cagra.1365s0013 *(Capsella grandiflora)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03634 (TCP)	IPR005333	Cagra.1365s0013	T344730_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TCP17 M07290_2.00	Arabidopsis thaliana	GTGGGGACCAC	GTGGTCCCCAC	Dap-seq OMalley et al.(2016) TCP17_col_a	0.964	0.691
TCP17 M07291_2.00	Arabidopsis thaliana	RTGGGGACCAC	GTGGTCCCCAY	Dap-seq OMalley et al.(2016) TCP17_colamp_a	0.964	0.691
TCP13 M07283_2.00	Arabidopsis thaliana	GTGGGGACCACWD	HWGTGGTCCCCAC	Dap-seq OMalley et al.(2016) PTF1_col_a	0.932	0.500
TCP13 M07284_2.00	Arabidopsis thaliana	NNBGGGACCACHN	NDGTGGTCCCVNN	Dap-seq OMalley et al.(2016) PTF1_colamp_a	0.932	0.500
TCP5 M02505_2.00	Arabidopsis thaliana	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH7523	0.926	0.582
TCP5 M02510_2.00	Arabidopsis lyrata	GGGACCAC	GTGGTCCC	PBM Weirauch et al.(2014) pTH9233	0.926	0.564
PK10344.1 M01313_2.00	Cannabis sativa	GGGACCAC	GTGGTCCC	PBM Lambert et al.(2019) pTH11464	0.900	0.491
LjT20A21.20.nc M02519_2.00	Lotus japonicus	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH9202	0.860	0.427
OS01G0213800 M11398_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PCF5_01	0.826	0.409
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cagra.1365s0013.1.p	TCP	47	212	FGGKDRHSKVFTVRGLRDRRIRLSVMTAIQVYDLQERLGLSQPSKVIDWLLEAAKNDVDLLPPLQFPPGSFHQVNPNLSQMGESFPGGVFDLGSCSNRDNMDLDNRKWARFDHNTSLDHGFDIDHHHFSNSIQSNKLYFPTSTTTSASSSYHYNIGHLQQSLLDQS

Links
Other TCP family TFs
Other *Capsella grandiflora* TFs

Invalid Input OrderBy

299 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action