TF Information

Carubv10018433m.g *(Capsella rubella)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03634 (TCP)	IPR005333	Carubv10018433m.g	T344761_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TCP16 M00893_2.00	Arabidopsis thaliana	NNGGNCCRB	VYGGNCCNN	PBM Franco-Zorrilla et al.(2014) TCP16	0.878	0.495
TCP16 M07287_2.00	Arabidopsis thaliana	RTKGGGYCCAC	GTGGRCCCMAY	Dap-seq OMalley et al.(2016) TCP16_col_a	0.878	0.495
TCP16 M07288_2.00	Arabidopsis thaliana	NRGGHCCACHN	NDGTGGDCCYN	Dap-seq OMalley et al.(2016) TCP16_colamp_a	0.878	0.495
TCP16 M02721_2.00	Arabidopsis thaliana	BBGGGHCCAC	GTGGDCCCVV	SELEX Mathelier et al.(2014) MA0587.1	0.878	0.495
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Carubv10018433m	TCP	15	151	RSHKDRHVRVGGRDRRIRLPANVAPQLFKLTKELGFHTDGETVNWLLQNAEPAIFAATGHGINTTPNNVINSNNNIHRYSLISGNNCTINNIFTCTGVNTGHPEMVFPGTSSTFPVKAEEDVPNQNQQQQQQPQGPQ

Links
Other TCP family TFs
Other *Capsella rubella* TFs

Invalid Input OrderBy

6 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action