TF Information

Eucgr.K02535 *(Eucalyptus grandis)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03634 (TCP)	IPR005333	Eucgr.K02535	T344806_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TCP5 M02510_2.00	Arabidopsis lyrata	GGGACCAC	GTGGTCCC	PBM Weirauch et al.(2014) pTH9233	0.899	0.446
TCP5 M02505_2.00	Arabidopsis thaliana	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH7523	0.894	0.446
PK10344.1 M01313_2.00	Cannabis sativa	GGGACCAC	GTGGTCCC	PBM Lambert et al.(2019) pTH11464	0.861	0.385
LjT20A21.20.nc M02519_2.00	Lotus japonicus	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH9202	0.832	0.377
TCP17 M07290_2.00	Arabidopsis thaliana	GTGGGGACCAC	GTGGTCCCCAC	Dap-seq OMalley et al.(2016) TCP17_col_a	0.830	0.385
TCP17 M07291_2.00	Arabidopsis thaliana	RTGGGGACCAC	GTGGTCCCCAY	Dap-seq OMalley et al.(2016) TCP17_colamp_a	0.830	0.385
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Eucgr.K02535.1	TCP	53	228	FGGKDRHSKVRTVRGLRDRRIRLSAPAAVQLYYLQDILGLTQPSKVIDWLIEAARHDIEKLPPLQIPQGFSEVINQQLLFPPESINFFDASLPFTKHGLISPSLTLLAGSAKMEVNEDCVWSADDRTRLKSKYYWDGISKLSERSNEFERGCFSDKSKQIDLNVRENQEDISSSGT

Links
Other TCP family TFs
Other *Eucalyptus grandis* TFs

Invalid Input OrderBy

154 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action