TF Information

Bra022786 *(Brassica rapa)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	Bra022786	T352310_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY25 M02552_2.00	Arabidopsis thaliana	YRGTCAAM	KTTGACYR	PBM Weirauch et al.(2014) pTH8810	0.881	0.913
WRKY25 M07387_2.00	Arabidopsis thaliana	HWWRGTCAAMR	YKTTGACYWWD	Dap-seq OMalley et al.(2016) WRKY25_col_a	0.881	0.913
WRKY25 M07388_2.00	Arabidopsis thaliana	NNNHWRGTCAACRNH	DNYGTTGACYWDNNN	Dap-seq OMalley et al.(2016) WRKY25_colamp_a	0.881	0.913
WRKY26 M07418_2.00	Arabidopsis thaliana	MWAAGTCAACGNH	DNCGTTGACTWWK	Dap-seq OMalley et al.(2016) WRKY26_col_a	0.862	0.722
WRKY26 M07419_2.00	Arabidopsis thaliana	HMWAGTCAAMR	YKTTGACTWKD	Dap-seq OMalley et al.(2016) WRKY26_colamp_a	0.862	0.722
Q40090_IPOBA M11466_2.00	Ipomoea batatas	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SPF1_Q2	0.860	0.748
WRKY33 M02554_2.00	Arabidopsis thaliana	NNRGTCHDNN	NNHDGACYNN	PBM Weirauch et al.(2014) pTH8183	0.856	0.722
WRKY33 M07391_2.00	Arabidopsis thaliana	HWWAGTCAAMD	HKTTGACTWWD	Dap-seq OMalley et al.(2016) WRKY33_col_a	0.856	0.722
WRKY20 M07414_2.00	Arabidopsis thaliana	HHHRGTCAAMGNH	DNCKTTGACYDDD	Dap-seq OMalley et al.(2016) WRKY20_col_a	0.843	0.687
WRKY3 M07381_2.00	Arabidopsis thaliana	MAWAGTCAAMR	YKTTGACTWTK	Dap-seq OMalley et al.(2016) WRKY3_col_a	0.841	0.713
PK05432.1 M01324_2.00	Cannabis sativa	NNRGTCARH	DYTGACYNN	PBM Lambert et al.(2019) pTH11342	0.840	0.704
WRKY2 M02567_2.00	Arabidopsis thaliana	BRGTCAAM	KTTGACYV	PBM Weirauch et al.(2014) pTH8832	0.834	0.687
ZAP1 M02726_2.00	Arabidopsis thaliana	DRCKCGGTCAA	TTGACCGMGYH	SELEX Mathelier et al.(2014) MA0589.1	0.821	0.565
ZAP1 M11463_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ZAP1_01	0.821	0.565
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bra022786.1-P	WRKY	154	210	NDGYGWRKYGQKQVKKSENPRSYFKCTYPNCFSKKIVETASDGQVTEIIYKGDHKHP
Bra022786.1-P	WRKY	313	370	VDGFRWRKYGQKVVKGNTNPRNYYKCTFQGCGVRKQIERSAEDERAVLTTYEGRHNHD

Links
Other WRKY family TFs
Other *Brassica rapa* TFs

Invalid Input OrderBy

773 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Bra022786 (Brassica rapa) WRKY

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

773 Related TFs

Invalid Input OrderBy

Bra022786 **(Brassica rapa)
WRKY**