TF Information

GRMZM2G005207 *(Zea mays)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	GRMZM2G005207	T352791_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY29 M02558_2.00	Arabidopsis thaliana	NNNGTCHDNN	NNHDGACNNN	PBM Weirauch et al.(2014) pTH9604	0.816	0.500
WRKY29 M07410_2.00	Arabidopsis thaliana	HAAAGTCAACK	MGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY29_col_a	0.816	0.500
WRKY29 M07411_2.00	Arabidopsis thaliana	HWWAGTCAAMDNN	NNHKTTGACTWWD	Dap-seq OMalley et al.(2016) WRKY29_colamp_a	0.816	0.500
WRKY62 M02561_2.00	Arabidopsis thaliana	TRGTCAAM	KTTGACYA	PBM Weirauch et al.(2014) pTH8246	0.811	0.467
WRKY22 M02557_2.00	Arabidopsis thaliana	NNNKTMHDNN	NNHDKAMNNN	PBM Weirauch et al.(2014) pTH7320	0.808	0.500
WRKY22 M07400_2.00	Arabidopsis thaliana	AAAAGTCAACKNH	DNMGTTGACTTTT	Dap-seq OMalley et al.(2016) WRKY22_colamp_a	0.808	0.500
WRKY22 M07401_2.00	Arabidopsis thaliana	NAAAGTCAACKNH	DNMGTTGACTTTN	Dap-seq OMalley et al.(2016) WRKY22_col	0.808	0.500
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GRMZM2G005207_P01	WRKY	111	175	FDGYQWRKYGQKQIEGAMYPRSYYRCIQSAKQGCQAKRTVQRNDDDGATAPPEYTVVYVAEHTCT

Links
Other WRKY family TFs
Other *Zea mays* TFs

Invalid Input OrderBy

210 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action