TF Information

GSMUA_Achr7G14140_001 *(Musa acuminata)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	GSMUA_Achr7G14140_001	T353017_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY53 M01090_2.00	Arabidopsis thaliana	RGTCAACNN	NNGTTGACY	PBM Sullivan et al.(2014) pTH8245	0.837	0.695
WRKY30 M02563_2.00	Arabidopsis thaliana	RGTCAACNNN	NNNGTTGACY	PBM Weirauch et al.(2014) pTH7611	0.830	0.661
WRKY30 M07422_2.00	Arabidopsis thaliana	DAAGTCAACGN	NCGTTGACTTH	Dap-seq OMalley et al.(2016) WRKY30_col_a	0.830	0.661
WRKY30 M07423_2.00	Arabidopsis thaliana	NNAAGTCAACGNH	DNCGTTGACTTNN	Dap-seq OMalley et al.(2016) WRKY30_colamp_a	0.830	0.661
WRKY55 M07392_2.00	Arabidopsis thaliana	HWAGTCAACGNH	DNCGTTGACTWD	Dap-seq OMalley et al.(2016) WRKY55_col_a	0.828	0.644
WRKY46 M07395_2.00	Arabidopsis thaliana	VAAAGTCAAMG	CKTTGACTTTB	Dap-seq OMalley et al.(2016) WRKY46_col_a	0.820	0.627
WRKY46 M07396_2.00	Arabidopsis thaliana	HRAAGTCAACG	CGTTGACTTYD	Dap-seq OMalley et al.(2016) WRKY46_colamp_a	0.820	0.627
WRKY70 M07399_2.00	Arabidopsis thaliana	HAAAGTCAACGNN	NNCGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY70_col	0.814	0.627
WRKY11 M02559_2.00	Arabidopsis thaliana	NDGTCAAHNN	NNDTTGACHN	PBM Weirauch et al.(2014) pTH8091	0.810	0.576
WRKY11 M07415_2.00	Arabidopsis thaliana	NHAAAGTCAACBNH	DNVGTTGACTTTDN	Dap-seq OMalley et al.(2016) WRKY11_col_a	0.810	0.576
WRKY11 M11464_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WRKY11_Q2	0.810	0.576
Q40828_PETCR M11467_2.00	Petroselinum crispum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WRKY_Q2	0.808	0.559
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GSMUA_Achr7P14140_001	WRKY	136	196	EDGYSWRKYGQKEILGARHPRGYYRCSHRNSVGCLATKQVQRSDQDPCVFDITYRGEHTCL

Links
Other WRKY family TFs
Other *Musa acuminata* TFs

Invalid Input OrderBy

657 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

GSMUA_Achr7G14140_001 (Musa acuminata) WRKY

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

657 Related TFs

Invalid Input OrderBy

GSMUA_Achr7G14140_001 **(Musa acuminata)
WRKY**