TF Information

Sb09g023270 *(Sorghum bicolor)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	Sb09g023270	T354571_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY33 M02554_2.00	Arabidopsis thaliana	NNRGTCHDNN	NNHDGACYNN	PBM Weirauch et al.(2014) pTH8183	0.870	0.878
WRKY33 M07391_2.00	Arabidopsis thaliana	HWWAGTCAAMD	HKTTGACTWWD	Dap-seq OMalley et al.(2016) WRKY33_col_a	0.870	0.878
Q40090_IPOBA M11466_2.00	Ipomoea batatas	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SPF1_Q2	0.867	0.878
WRKY26 M07418_2.00	Arabidopsis thaliana	MWAAGTCAACGNH	DNCGTTGACTWWK	Dap-seq OMalley et al.(2016) WRKY26_col_a	0.859	0.791
WRKY26 M07419_2.00	Arabidopsis thaliana	HMWAGTCAAMR	YKTTGACTWKD	Dap-seq OMalley et al.(2016) WRKY26_colamp_a	0.859	0.791
WRKY20 M07414_2.00	Arabidopsis thaliana	HHHRGTCAAMGNH	DNCKTTGACYDDD	Dap-seq OMalley et al.(2016) WRKY20_col_a	0.856	0.791
WRKY3 M07381_2.00	Arabidopsis thaliana	MAWAGTCAAMR	YKTTGACTWTK	Dap-seq OMalley et al.(2016) WRKY3_col_a	0.851	0.826
WRKY2 M02567_2.00	Arabidopsis thaliana	BRGTCAAM	KTTGACYV	PBM Weirauch et al.(2014) pTH8832	0.850	0.800
WRKY25 M02552_2.00	Arabidopsis thaliana	YRGTCAAM	KTTGACYR	PBM Weirauch et al.(2014) pTH8810	0.849	0.722
WRKY25 M07387_2.00	Arabidopsis thaliana	HWWRGTCAAMR	YKTTGACYWWD	Dap-seq OMalley et al.(2016) WRKY25_col_a	0.849	0.722
WRKY25 M07388_2.00	Arabidopsis thaliana	NNNHWRGTCAACRNH	DNYGTTGACYWDNNN	Dap-seq OMalley et al.(2016) WRKY25_colamp_a	0.849	0.722
PK05432.1 M01324_2.00	Cannabis sativa	NNRGTCARH	DYTGACYNN	PBM Lambert et al.(2019) pTH11342	0.847	0.800
ZAP1 M02726_2.00	Arabidopsis thaliana	DRCKCGGTCAA	TTGACCGMGYH	SELEX Mathelier et al.(2014) MA0589.1	0.826	0.661
ZAP1 M11463_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ZAP1_01	0.826	0.661
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Sb09g023270.1	WRKY	240	296	DDGYNWRKYGQKNMKGSENPRSYYKCSFPGCPTKKKVERSPDGQVTEIVYKGAHNHP
Sb09g023270.1	WRKY	416	473	DDGYRWRKYGQKVVKGNPNPRSYYKCTTAGCPVRKHVERACHDTRAVVTTYEGKHNHD

Links
Other WRKY family TFs
Other *Sorghum bicolor* TFs

Invalid Input OrderBy

780 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Sb09g023270 (Sorghum bicolor) WRKY

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

780 Related TFs

Invalid Input OrderBy

Sb09g023270 **(Sorghum bicolor)
WRKY**