TF Information

Traes_5DL_C93641E43 *(Triticum aestivum)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	Traes_5DL_C93641E43	T355027_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY30 M02563_2.00	Arabidopsis thaliana	RGTCAACNNN	NNNGTTGACY	PBM Weirauch et al.(2014) pTH7611	0.836	0.729
WRKY30 M07422_2.00	Arabidopsis thaliana	DAAGTCAACGN	NCGTTGACTTH	Dap-seq OMalley et al.(2016) WRKY30_col_a	0.836	0.729
WRKY30 M07423_2.00	Arabidopsis thaliana	NNAAGTCAACGNH	DNCGTTGACTTNN	Dap-seq OMalley et al.(2016) WRKY30_colamp_a	0.836	0.729
WRKY53 M01090_2.00	Arabidopsis thaliana	RGTCAACNN	NNGTTGACY	PBM Sullivan et al.(2014) pTH8245	0.834	0.712
WRKY55 M07392_2.00	Arabidopsis thaliana	HWAGTCAACGNH	DNCGTTGACTWD	Dap-seq OMalley et al.(2016) WRKY55_col_a	0.831	0.661
WRKY11 M02559_2.00	Arabidopsis thaliana	NDGTCAAHNN	NNDTTGACHN	PBM Weirauch et al.(2014) pTH8091	0.818	0.576
WRKY11 M07415_2.00	Arabidopsis thaliana	NHAAAGTCAACBNH	DNVGTTGACTTTDN	Dap-seq OMalley et al.(2016) WRKY11_col_a	0.818	0.576
WRKY11 M11464_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WRKY11_Q2	0.818	0.576
WRKY46 M07395_2.00	Arabidopsis thaliana	VAAAGTCAAMG	CKTTGACTTTB	Dap-seq OMalley et al.(2016) WRKY46_col_a	0.815	0.678
WRKY46 M07396_2.00	Arabidopsis thaliana	HRAAGTCAACG	CGTTGACTTYD	Dap-seq OMalley et al.(2016) WRKY46_colamp_a	0.815	0.678
Q40828_PETCR M11467_2.00	Petroselinum crispum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WRKY_Q2	0.815	0.559
WRKY17 M02550_2.00	Arabidopsis thaliana	NNDGTCAAHN	NDTTGACHNN	PBM Weirauch et al.(2014) pTH8088	0.811	0.542
WRKY17 M07385_2.00	Arabidopsis thaliana	NHAAAGTCAACRNN	NNYGTTGACTTTDN	Dap-seq OMalley et al.(2016) WRKY17_col_a	0.811	0.542
WRKY17 M07386_2.00	Arabidopsis thaliana	NMAAAGTCAACGN	NCGTTGACTTTKN	Dap-seq OMalley et al.(2016) WRKY17_colamp_a	0.811	0.542
WRKY70 M07399_2.00	Arabidopsis thaliana	HAAAGTCAACGNN	NNCGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY70_col	0.810	0.593
WRKY15 M02549_2.00	Arabidopsis thaliana	NRGTCAAMNN	NNKTTGACYN	PBM Weirauch et al.(2014) pTH7602	0.810	0.525
WRKY15 M07383_2.00	Arabidopsis thaliana	AAAAGTCAACKN	NMGTTGACTTTT	Dap-seq OMalley et al.(2016) WRKY15_colamp_a	0.810	0.525
WRKY15 M07384_2.00	Arabidopsis thaliana	NWAAGTCAACB	VGTTGACTTWN	Dap-seq OMalley et al.(2016) WRKY15_col_b	0.810	0.525
WRKY7 M07412_2.00	Arabidopsis thaliana	NNDDDNNNNMAAAGTCAACGV	BCGTTGACTTTKNNNNHHHNN	Dap-seq OMalley et al.(2016) WRKY7_colamp_a	0.808	0.525
WRKY7 M07413_2.00	Arabidopsis thaliana	NAAAAGTCAACKNN	NNMGTTGACTTTTN	Dap-seq OMalley et al.(2016) WRKY7_col	0.808	0.525
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Traes_5DL_C93641E43.1	WRKY	121	181	DDGHSWRKYGQKDILGAKHPRGYYRCTHRKSQGCAATKQVQRADEDPALFDVIYHGEHTCV

Links
Other WRKY family TFs
Other *Triticum aestivum* TFs

Invalid Input OrderBy

858 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Traes_5DL_C93641E43 (Triticum aestivum) WRKY

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

858 Related TFs

Invalid Input OrderBy

Traes_5DL_C93641E43 **(Triticum aestivum)
WRKY**