TF Information

VIT_04s0008g01470 *(Vitis vinifera)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	VIT_04s0008g01470	T355152_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY50 M07424_2.00	Arabidopsis thaliana	NNAAAAGTCAAMN	NKTTGACTTTTNN	Dap-seq OMalley et al.(2016) WRKY50_col_a	0.861	0.862
WRKY50 M07425_2.00	Arabidopsis thaliana	NWAAGTCAANN	NNTTGACTTWN	Dap-seq OMalley et al.(2016) WRKY50_colamp_a	0.861	0.862
PK25870.1 M01325_2.00	Cannabis sativa	NRGTCAAM	KTTGACYN	PBM Lambert et al.(2019) pTH10156	0.854	0.862
WRKY51 M02568_2.00	Arabidopsis thaliana	NNRGTCAANN	NNTTGACYNN	PBM Weirauch et al.(2014) pTH7478	0.841	0.776
WRKY48 M02565_2.00	Arabidopsis thaliana	NNVGTCADNN	NNHTGACBNN	PBM Weirauch et al.(2014) pTH7552	0.812	0.672
WRKY71 M07374_2.00	Arabidopsis thaliana	HAAAGTCAAMN	NKTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY71_col_a	0.811	0.690
WRKY28 M07406_2.00	Arabidopsis thaliana	HAAAGTCAAMNNH	DNNKTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY28_col_a	0.810	0.690
WRKY28 M07407_2.00	Arabidopsis thaliana	VAAAGTCAAMG	CKTTGACTTTB	Dap-seq OMalley et al.(2016) WRKY28_colamp_a	0.810	0.690
WRKY8 M02564_2.00	Arabidopsis thaliana	NRGTCAAHN	NDTTGACYN	PBM Weirauch et al.(2014) pTH7554	0.810	0.672
WRKY8 M07428_2.00	Arabidopsis thaliana	NAAAAGTCAACRNHW	WDNYGTTGACTTTTN	Dap-seq OMalley et al.(2016) WRKY8_colamp_a	0.810	0.672
WRKY8 M07429_2.00	Arabidopsis thaliana	NNVAAAGTCAACRNH	DNYGTTGACTTTBNN	Dap-seq OMalley et al.(2016) WRKY8_col	0.810	0.672
ZAP1 M00982_2.00	Arabidopsis thaliana	NRGTCAAN	NTTGACYN	PBM Lindemose et al.(2014) WRKY1	0.809	0.638
WRKY57 M02547_2.00	Arabidopsis thaliana	NNRGTCAAHN	NDTTGACYNN	PBM Weirauch et al.(2014) pTH7917	0.809	0.655
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
VIT_04s0008g01470.t01	WRKY	104	161	DDGFKWRKYGKKMVKNSPNPRNYYRCSVDGCNVKKRVERDREDPKYVITTYEGIHNHE

Links
Other WRKY family TFs
Other *Vitis vinifera* TFs

Invalid Input OrderBy

567 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

VIT_04s0008g01470 (Vitis vinifera) WRKY

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

567 Related TFs

Invalid Input OrderBy

VIT_04s0008g01470 **(Vitis vinifera)
WRKY**