TF Information

Carubv10025742m.g *(Capsella rubella)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03106 (WRKY)	IPR003657	Carubv10025742m.g	T355998_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY70 M07399_2.00	Arabidopsis thaliana	HAAAGTCAACGNN	NNCGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY70_col	0.820	0.661
WRKY14 M00731_2.00	Arabidopsis thaliana	NRGTCAAMNN	NNKTTGACYN	PBM Chang et al.(2013) pTH7570	0.820	0.661
WRKY14 M07375_2.00	Arabidopsis thaliana	NAAAGTCAACGNN	NNCGTTGACTTTN	Dap-seq OMalley et al.(2016) WRKY14_col_a	0.820	0.661
WRKY14 M07376_2.00	Arabidopsis thaliana	NAAAGTCAACGNH	DNCGTTGACTTTN	Dap-seq OMalley et al.(2016) WRKY14_colamp_a	0.820	0.661
WRKY27 M02566_2.00	Arabidopsis thaliana	NNGTCHDNN	NNHDGACNN	PBM Weirauch et al.(2014) pTH8188	0.817	0.593
WRKY27 M07430_2.00	Arabidopsis thaliana	MAAAGTCAACKNH	DNMGTTGACTTTK	Dap-seq OMalley et al.(2016) WRKY27_col_a	0.817	0.593
WRKY27 M07431_2.00	Arabidopsis thaliana	HAAAGTCAACKNH	DNMGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY27_colamp_a	0.817	0.593
WRKY46 M07395_2.00	Arabidopsis thaliana	VAAAGTCAAMG	CKTTGACTTTB	Dap-seq OMalley et al.(2016) WRKY46_col_a	0.813	0.576
WRKY46 M07396_2.00	Arabidopsis thaliana	HRAAGTCAACG	CGTTGACTTYD	Dap-seq OMalley et al.(2016) WRKY46_colamp_a	0.813	0.576
WRKY65 M07372_2.00	Arabidopsis thaliana	NWWAGTCAACG	CGTTGACTWWN	Dap-seq OMalley et al.(2016) WRKY65_col_a	0.812	0.627
WRKY65 M07373_2.00	Arabidopsis thaliana	NAAAGTCAACGN	NCGTTGACTTTN	Dap-seq OMalley et al.(2016) WRKY65_colamp_a	0.812	0.627
WRKY53 M01090_2.00	Arabidopsis thaliana	RGTCAACNN	NNGTTGACY	PBM Sullivan et al.(2014) pTH8245	0.810	0.593
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Carubv10025742m	WRKY	1215	1275	EDLWSWRKYGKKEILGSLFPRSYFRCTHKFAQGCKATKQVQRSDTDPNMFTITYLSEHNHP

Links
Other WRKY family TFs
Other *Capsella rubella* TFs

Invalid Input OrderBy

458 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Carubv10025742m.g (Capsella rubella) WRKY

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

458 Related TFs

Invalid Input OrderBy

Carubv10025742m.g **(Capsella rubella)
WRKY**