TF Information

evm.TU.supercontig_184.33 *(Carica papaya)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03106 (WRKY)	IPR003657	evm.TU.supercontig_184.33	T356162_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY22 M02557_2.00	Arabidopsis thaliana	NNNKTMHDNN	NNHDKAMNNN	PBM Weirauch et al.(2014) pTH7320	0.811	0.787
WRKY22 M07400_2.00	Arabidopsis thaliana	AAAAGTCAACKNH	DNMGTTGACTTTT	Dap-seq OMalley et al.(2016) WRKY22_colamp_a	0.811	0.787
WRKY22 M07401_2.00	Arabidopsis thaliana	NAAAGTCAACKNH	DNMGTTGACTTTN	Dap-seq OMalley et al.(2016) WRKY22_col	0.811	0.787
WRKY65 M07372_2.00	Arabidopsis thaliana	NWWAGTCAACG	CGTTGACTWWN	Dap-seq OMalley et al.(2016) WRKY65_col_a	0.809	0.660
WRKY65 M07373_2.00	Arabidopsis thaliana	NAAAGTCAACGN	NCGTTGACTTTN	Dap-seq OMalley et al.(2016) WRKY65_colamp_a	0.809	0.660
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
evm.model.supercontig_184.33	WRKY	115	165	TAANSHTPRSKRRGYYRCSSSKGCLARKQVERNRSDPTIFIVTYTAEHNHP

Links
Other WRKY family TFs
Other *Carica papaya* TFs

Invalid Input OrderBy

63 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action