TF Information

Pavir.Eb03562 *(Panicum virgatum)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03106 (WRKY)	IPR003657	Pavir.Eb03562	T356759_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY21 M02553_2.00	Arabidopsis thaliana	NNRGTCAAMN	NKTTGACYNN	PBM Weirauch et al.(2014) pTH7422	0.808	0.467
WRKY21 M07389_2.00	Arabidopsis thaliana	HAAAGTCAACNNH	DNNGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY21_colamp_a	0.808	0.467
WRKY21 M07390_2.00	Arabidopsis thaliana	HAAAGTCAACK	MGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY21_col	0.808	0.467
WRKY62 M02561_2.00	Arabidopsis thaliana	TRGTCAAM	KTTGACYA	PBM Weirauch et al.(2014) pTH8246	0.808	0.450
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pavir.Eb03562.1.p	WRKY	126	187	YDGYQWRKYGQKRITKTHYPRCYYRCSFHRERGCRATKQVQQCSGGDQPQYLVIYFYDHTCD

Links
Other WRKY family TFs
Other *Panicum virgatum* TFs

Invalid Input OrderBy

136 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action