TF Information

PDK_20s1338281g001 *(Phoenix dactylifera)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03106 (WRKY)	IPR003657	PDK_20s1338281g001	T357191_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY3 M07381_2.00	Arabidopsis thaliana	MAWAGTCAAMR	YKTTGACTWTK	Dap-seq OMalley et al.(2016) WRKY3_col_a	0.872	0.748
Q40090_IPOBA M11466_2.00	Ipomoea batatas	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SPF1_Q2	0.859	0.765
WRKY20 M07414_2.00	Arabidopsis thaliana	HHHRGTCAAMGNH	DNCKTTGACYDDD	Dap-seq OMalley et al.(2016) WRKY20_col_a	0.854	0.678
WRKY2 M02567_2.00	Arabidopsis thaliana	BRGTCAAM	KTTGACYV	PBM Weirauch et al.(2014) pTH8832	0.852	0.730
PK05432.1 M01324_2.00	Cannabis sativa	NNRGTCARH	DYTGACYNN	PBM Lambert et al.(2019) pTH11342	0.852	0.722
WRKY33 M02554_2.00	Arabidopsis thaliana	NNRGTCHDNN	NNHDGACYNN	PBM Weirauch et al.(2014) pTH8183	0.852	0.730
WRKY33 M07391_2.00	Arabidopsis thaliana	HWWAGTCAAMD	HKTTGACTWWD	Dap-seq OMalley et al.(2016) WRKY33_col_a	0.852	0.730
WRKY26 M07418_2.00	Arabidopsis thaliana	MWAAGTCAACGNH	DNCGTTGACTWWK	Dap-seq OMalley et al.(2016) WRKY26_col_a	0.850	0.696
WRKY26 M07419_2.00	Arabidopsis thaliana	HMWAGTCAAMR	YKTTGACTWKD	Dap-seq OMalley et al.(2016) WRKY26_colamp_a	0.850	0.696
ZAP1 M02726_2.00	Arabidopsis thaliana	DRCKCGGTCAA	TTGACCGMGYH	SELEX Mathelier et al.(2014) MA0589.1	0.846	0.626
ZAP1 M11463_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ZAP1_01	0.846	0.626
WRKY25 M02552_2.00	Arabidopsis thaliana	YRGTCAAM	KTTGACYR	PBM Weirauch et al.(2014) pTH8810	0.839	0.635
WRKY25 M07387_2.00	Arabidopsis thaliana	HWWRGTCAAMR	YKTTGACYWWD	Dap-seq OMalley et al.(2016) WRKY25_col_a	0.839	0.635
WRKY25 M07388_2.00	Arabidopsis thaliana	NNNHWRGTCAACRNH	DNYGTTGACYWDNNN	Dap-seq OMalley et al.(2016) WRKY25_colamp_a	0.839	0.635
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
PDK_20s1338281g001	WRKY	120	176	YDGYNWRKYGQKQVKGSEYPRSYYKCTHPSCPVKKKVERSLDGKIAEIVYRSEHNHP
PDK_20s1338281g001	WRKY	320	377	GDGFHWRKYGQKVVKGNPYPRSYYRCTSPKCNVRKYVEKASDESGSFVTTYEGKHNHE

Links
Other WRKY family TFs
Other *Phoenix dactylifera* TFs

Invalid Input OrderBy

789 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

PDK_20s1338281g001 (Phoenix dactylifera) WRKY

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

789 Related TFs

Invalid Input OrderBy

PDK_20s1338281g001 **(Phoenix dactylifera)
WRKY**