TF Information

PDK_20s1521921g002 *(Phoenix dactylifera)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03106 (WRKY)	IPR003657	PDK_20s1521921g002	T357214_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY53 M01090_2.00	Arabidopsis thaliana	RGTCAACNN	NNGTTGACY	PBM Sullivan et al.(2014) pTH8245	0.849	0.746
WRKY30 M02563_2.00	Arabidopsis thaliana	RGTCAACNNN	NNNGTTGACY	PBM Weirauch et al.(2014) pTH7611	0.843	0.712
WRKY30 M07422_2.00	Arabidopsis thaliana	DAAGTCAACGN	NCGTTGACTTH	Dap-seq OMalley et al.(2016) WRKY30_col_a	0.843	0.712
WRKY30 M07423_2.00	Arabidopsis thaliana	NNAAGTCAACGNH	DNCGTTGACTTNN	Dap-seq OMalley et al.(2016) WRKY30_colamp_a	0.843	0.712
WRKY55 M07392_2.00	Arabidopsis thaliana	HWAGTCAACGNH	DNCGTTGACTWD	Dap-seq OMalley et al.(2016) WRKY55_col_a	0.826	0.644
WRKY46 M07395_2.00	Arabidopsis thaliana	VAAAGTCAAMG	CKTTGACTTTB	Dap-seq OMalley et al.(2016) WRKY46_col_a	0.817	0.678
WRKY46 M07396_2.00	Arabidopsis thaliana	HRAAGTCAACG	CGTTGACTTYD	Dap-seq OMalley et al.(2016) WRKY46_colamp_a	0.817	0.678
WRKY70 M07399_2.00	Arabidopsis thaliana	HAAAGTCAACGNN	NNCGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY70_col	0.813	0.593
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
PDK_20s1521921g002	WRKY	128	188	DDGHSWRKYGQKDILGATYPRGYYRCTHRNTQGCLATKQVQRSDENPSVFDVTYHGTHTCH

Links
Other WRKY family TFs
Other *Phoenix dactylifera* TFs

Invalid Input OrderBy

512 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action