CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

SKUD_189302 *(Saccharomyces kudriavzevii)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00172 (Zn_clus)	IPR001138	SKUD_189302	T383886_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PDR3 M00918_2.00	Saccharomyces cerevisiae	NBCCGCGGRNN	NNYCCGCGGVN	PBM Gordan et al.(2011) Pdr3	0.678	0.921
PDR3 M08438_2.00	Saccharomyces cerevisiae	TCCGCGGA	TCCGCGGA	ChIP-chip Mathelier et al.(2014) MA0353.1	0.678	0.921
PDR3 M08642_2.00	Saccharomyces cerevisiae	NVCGGA	TCCGBN	Misc DeBoer et al.(2011) YBL005W_1387	0.678	0.921
PDR3 M08643_2.00	Saccharomyces cerevisiae	WCHGCGGN	NCCGCDGW	Misc DeBoer et al.(2011) YBL005W_2062	0.678	0.921
PDR3 M11475_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$PDR3_Q2	0.678	0.921
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EJT41660	Zinc cluster	54	91	TACVNCRKRKIKCTGKHPCTNCISYDCTCVFLKRYLPQ

Links
Other Zinc cluster family TFs
Other *Saccharomyces kudriavzevii* TFs