CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GLYMA16G26320 *(Glycine max)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	GLYMA16G26320	T001994_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF115 M06657_2.00	Arabidopsis thaliana	CCGCCGYMRYHDCCR	YGGHDRYKRCGGCGG	Dap-seq OMalley et al.(2016) ERF115_col_a	0.810	0.860
ERF115 M06658_2.00	Arabidopsis thaliana	CKCCGCCGYMRYHDY	RHDRYKRCGGCGGMG	Dap-seq OMalley et al.(2016) ERF115_colamp_a	0.810	0.860
RAP2-6 M00717_2.00	Arabidopsis thaliana	NBGCYGNH	DNCRGCVN	PBM Chang et al.(2013) pTH7225	0.792	0.860
RAP2-6 M00841_2.00	Arabidopsis thaliana	NGCCGHHNNN	NNNDDCGGCN	PBM Franco-Zorrilla et al.(2014) RAP2.6	0.792	0.860
RAP2-6 M06579_2.00	Arabidopsis thaliana	HHDYCKCCGCCGYMD	HKRCGGCGGMGRHDD	Dap-seq OMalley et al.(2016) RAP26_col_a	0.792	0.860
RAP2-6 M06580_2.00	Arabidopsis thaliana	CGCCGY	RCGGCG	Dap-seq OMalley et al.(2016) RAP26_colamp_a	0.792	0.860
ERF113 M01629_2.00	Arabidopsis thaliana	NNGCCGHHNN	NNDDCGGCNN	PBM Weirauch et al.(2014) pTH8097	0.756	0.860
AT2G33710 M01613_2.00	Arabidopsis thaliana	NSMGCCGHMN	NKDCGGCKSN	PBM Weirauch et al.(2014) pTH7543	0.730	0.800
AT2G33710 M06606_2.00	Arabidopsis thaliana	DBCGCCGCCGYHDHHDNH	DNHDDHDRCGGCGGCGVH	Dap-seq OMalley et al.(2016) At2g33710_colamp_a	0.730	0.800
AT2G33710 M06607_2.00	Arabidopsis thaliana	NHDYCKCCGCCGYMD	HKRCGGCGGMGRHDN	Dap-seq OMalley et al.(2016) At2g33710_col	0.730	0.800
A5JTT1_WHEAT M09700_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ERF3_01	0.708	0.760
LOC_Os08g36920 M01634_2.00	Oryza sativa	NNNGSCGHNN	NNDCGSCNNN	PBM Weirauch et al.(2014) pTH8596	0.704	0.740
A4F248_TOBAC M09725_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WRAF1_01	0.703	0.800
A4F249_TOBAC M09726_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WRAF2_01	0.698	0.780
ABR1 M01051_2.00	Arabidopsis thaliana	NYGSCGSCVNN	NNBGSCGSCRN	PBM Sullivan et al.(2014) pTH7383	0.695	0.780
ABR1 M06684_2.00	Arabidopsis thaliana	CKCCGCCGYMDHHNYHNHH	DDNDRNDDHKRCGGCGGMG	Dap-seq OMalley et al.(2016) ABR1_col_a	0.695	0.780
ABR1 M06685_2.00	Arabidopsis thaliana	HNNHDSCGCCGCMAWHNNNNN	NNNNNDWTKGCGGCGSHDNND	Dap-seq OMalley et al.(2016) ABR1_colamp_a	0.695	0.780
ERF5 M00721_2.00	Arabidopsis thaliana	NNNGSMRNMN	NKNYKSCNNN	PBM Chang et al.(2013) pTH7197	0.695	0.760
ERF5 M06674_2.00	Arabidopsis thaliana	YCDYCKCCGCCGYCD	HGRCGGCGGMGRHGR	Dap-seq OMalley et al.(2016) ERF5_col_a	0.695	0.760
ERF5 M06675_2.00	Arabidopsis thaliana	NHDBCGCCGCCRYHDNHDNNN	NNNHDNHDRYGGCGGCGVHDN	Dap-seq OMalley et al.(2016) ERF5_colamp_a	0.695	0.760
ERF2_TOBAC M09727_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ERF2_01	0.684	0.720
RAP2-2 M00719_2.00	Arabidopsis thaliana	NNRBYGNN	NNCRVYNN	PBM Chang et al.(2013) pTH7227	0.684	0.740
ERF094 M01602_2.00	Arabidopsis thaliana	VGCCGCCD	HGGCGGCB	PBM Weirauch et al.(2014) pTH8276	0.679	0.740
ERF1A M00848_2.00	Arabidopsis thaliana	NNNNRNN	NNYNNNN	PBM Franco-Zorrilla et al.(2014) ATERF1	0.679	0.760
ERF1A M00720_2.00	Arabidopsis thaliana	NMGCCRNCN	NGNYGGCKN	PBM Chang et al.(2013) pTH7202	0.679	0.760
ERF2 M01631_2.00	Arabidopsis thaliana	NNNGCCGNCN	NGNCGGCNNN	PBM Weirauch et al.(2014) pTH8113	0.679	0.760
ERF2 M06672_2.00	Arabidopsis thaliana	HHNHHNYHDYCGCCGCCRYND	HNRYGGCGGCGRHDRNDDNDD	Dap-seq OMalley et al.(2016) ERF2_col_a	0.679	0.760
ERF2 M06673_2.00	Arabidopsis thaliana	NNNNNNNHNNHDSMGCCGCCR	YGGCGGCKSHDNNDNNNNNNN	Dap-seq OMalley et al.(2016) ERF2_colamp_a	0.679	0.760
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GLYMA16G26320.1	AP2	43	94	KHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAMAYDAAALRFKGN

Links
Other AP2 family TFs
Other *Glycine max* TFs

703 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
gw1.66.31.1	Phycomyces blakesleeanus	gw1.66.31.1	I
H102_04265	Trichophyton rubrum	H102_04265	I
H105_04290	Trichophyton soudanense	H105_04290	I
L804_04848	Cryptococcus gattii	L804_04848	I
pp-1	Neurospora crassa	NCU00340	D

GLYMA16G26320 (Glycine max) AP2

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

703 Related TFs

GLYMA16G26320 **(Glycine max)
AP2**