CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

POPTR_0019s11780 *(Populus trichocarpa)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	POPTR_0019s11780	T004759_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q84J59_MAIZE M09717_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$BD1_01	0.736	0.694
ERF086 M06663_2.00	Arabidopsis thaliana	HHDYCKCCGCCGYHD	HDRCGGCGGMGRHDD	Dap-seq OMalley et al.(2016) PUCHI_col_a	0.732	0.694
ERF086 M06664_2.00	Arabidopsis thaliana	NNNNHDHCKCCGCCGYHDHHDHNNN	NNNDHDDHDRCGGCGGMGDHDNNNN	Dap-seq OMalley et al.(2016) PUCHI_colamp_a	0.732	0.694
LEP M06661_2.00	Arabidopsis thaliana	NBCKCCGCCGYHDHHDYHNHH	DDNDRHDDHDRCGGCGGMGVN	Dap-seq OMalley et al.(2016) LEP_col_a	0.726	0.714
ERF087 M06573_2.00	Arabidopsis thaliana	HHDYCKCCGCCGYYD	HRRCGGCGGMGRHDD	Dap-seq OMalley et al.(2016) AT1G28160_col_a	0.708	0.673
ERF087 M06574_2.00	Arabidopsis thaliana	HDYCKCCGCCGYCR	YGRCGGCGGMGRHD	Dap-seq OMalley et al.(2016) AT1G28160_colamp_a	0.708	0.673
ERF11 M01606_2.00	Arabidopsis thaliana	NHGCCGNHNN	NNDNCGGCDN	PBM Weirauch et al.(2014) pTH8117	0.704	0.714
ERF11 M06575_2.00	Arabidopsis thaliana	NHNNHDSCGCCGYCRHHNNN	NNNDDYGRCGGCGSHDNNDN	Dap-seq OMalley et al.(2016) ERF11_colamp_a	0.704	0.714
ERF11 M06576_2.00	Arabidopsis thaliana	NHNYCKCCGCCGYHD	HDRCGGCGGMGRNDN	Dap-seq OMalley et al.(2016) ERF11_col_b	0.704	0.714
ERF10 M06562_2.00	Arabidopsis thaliana	NNHNNHNHHDYCGCCGCCRYN	NRYGGCGGCGRHDDNDNNDNN	Dap-seq OMalley et al.(2016) ERF10_col_a	0.693	0.653
ERF10 M06563_2.00	Arabidopsis thaliana	HDSCGCCGCCRHHDNNNNNN	NNNNNNHDDYGGCGGCGSHD	Dap-seq OMalley et al.(2016) ERF10_colamp_a	0.693	0.653
ERF4 M01616_2.00	Arabidopsis thaliana	VCGCCGCC	GGCGGCGB	PBM Weirauch et al.(2014) pTH8156	0.682	0.653
ERF4 M06616_2.00	Arabidopsis thaliana	YCDCCGCCGCCRHHD	HDDYGGCGGCGGHGR	Dap-seq OMalley et al.(2016) ERF4_col_a	0.682	0.653
ERF4 M06617_2.00	Arabidopsis thaliana	NHNNHNSCGCCGYCRHHDNN	NNHDDYGRCGGCGSNDNNDN	Dap-seq OMalley et al.(2016) ERF4_colamp_a	0.682	0.653
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
POPTR_0019s11780.1	AP2	20	69	SRYLGVRRRPWGRYAAEIRNPYTKERHWLGTFDTAEEAAVAYDLSSISFS

Links
Other AP2 family TFs
Other *Populus trichocarpa* TFs

358 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
GK21672	Drosophila willistoni	FBgn0223657	N	0.000
GK22442	Drosophila willistoni	FBgn0224419	N	0.000
GUITHDRAFT_116448	Guillardia theta	GUITHDRAFT_116448	N	0.000

POPTR_0019s11780 (Populus trichocarpa) AP2

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

358 Related TFs

POPTR_0019s11780 **(Populus trichocarpa)
AP2**