CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Solyc02g091800.2 *(Solanum lycopersicum)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	Solyc02g091800.2	T045039_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT2G22750 M06730_2.00	Arabidopsis thaliana	MRYGTKDNHCACGTGNN	NNCACGTGDNHMACRYK	Dap-seq OMalley et al.(2016) bHLH18_col_a	0.854	0.735
MYC2 M01699_2.00	Arabidopsis thaliana	NNCACGTGNN	NNCACGTGNN	PBM Weirauch et al.(2014) pTH8083	0.848	0.510
PK18474.1 M01127_2.00	Cannabis sativa	NRCACGTGCN	NGCACGTGYN	PBM Lambert et al.(2019) pTH10273	0.848	0.510
PK18474.1 M01768_2.00	Cannabis sativa	NCACGWK	MWCGTGN	PBM Weirauch et al.(2014) pTH9589	0.848	0.510
MYC4 M01707_2.00	Arabidopsis thaliana	NNCACGTGNN	NNCACGTGNN	PBM Weirauch et al.(2014) pTH8260	0.848	0.490
MYC3 M01712_2.00	Arabidopsis thaliana	MWYGTGNNNN	NNNNCACRWK	PBM Weirauch et al.(2014) pTH8854	0.848	0.490
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Solyc02g091800.2.1	bHLH	174	222	LQDHIIAERKRREKLSQRFVALSTILPGLKKVDKASILEQAIKHVKDLK

Links
Other bHLH family TFs
Other *Solanum lycopersicum* TFs