CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Sb02g004590 *(Sorghum bicolor)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	Sb02g004590	T067666_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
O2 M08078_2.00	Zea mays	GMTGACRTGGCRN	NYGCCAYGTCAKC	ChIP-seq Mathelier et al.(2014) MA1417.1	0.885	0.889
O2 M10036_2.00	Zea mays	TCATTCCACGTAGATR	YATCTACGTGGAATGA	Transfac Matys et al.(2006) P$O2_01	0.885	0.889
O2 M10037_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$O2_02	0.885	0.889
O2 M10038_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$O2_03	0.885	0.889
O2 M10039_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$O2_Q2	0.885	0.889
OP2_MAIZE M10045_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$O2_Q4	0.829	0.778
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Sb02g004590.1	bZIP	236	298	TEERVRKRKESNRESARRSRYRKAAHLKDLEDQVEKLKAENSCLLRRLAAMNRKYNEANVDNR

Links
Other bZIP family TFs
Other *Sorghum bicolor* TFs