CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Sb10g007090 *(Sorghum bicolor)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	Sb10g007090	T067744_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
OS08G0471950 M10047_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TRAB1_Q2	0.797	0.702
ABF2 M01771_2.00	Arabidopsis thaliana	NNYACGTGTHNNN	NNNDACACGTRNN	PBM Weirauch et al.(2014) pTH8103	0.790	0.684
ABF2 M06755_2.00	Arabidopsis thaliana	NNWNNTGMCACGTSWBMH	DKVWSACGTGKCANNWNN	Dap-seq OMalley et al.(2016) ABF2_col_v3a	0.790	0.684
ABF3 M01782_2.00	Arabidopsis thaliana	ACACGTGT	ACACGTGT	PBM Weirauch et al.(2014) pTH7240	0.784	0.754
ABF3 M09912_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ABF3_Q2	0.784	0.754
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Sb10g007090.1	bZIP	266	323	VERRQRRMIKNRESAARSRARKQAYIMELEAEVAKLKDQNDELQKKQVEMLKKQKDEK

Links
Other bZIP family TFs
Other *Sorghum bicolor* TFs