CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

TBLA_0C02390 *(Tetrapisispora blattae)* Forkhead
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00250 (Forkhead)	IPR001766	TBLA_0C02390	T188627_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FHL1 M00046_2.00	Saccharomyces cerevisiae	NGACGCAM	KTGCGTCN	PBM Badis et al.(2008) FHL1_2086	0.791	0.817
FHL1 M01543_2.00	Saccharomyces cerevisiae	NVDCGCRNN	NNYGCGHBN	PBM Zhu et al.(2009) Fhl1	0.791	0.817
FHL1 M07475_2.00	Saccharomyces cerevisiae	GACGCAVN	NBTGCGTC	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0295.1	0.791	0.817
FHL1 M08557_2.00	Saccharomyces cerevisiae	NNNDDNGACGCAMWNNNNDN	NHNNNNWKTGCGTCNHHNNN	Misc DeBoer et al.(2011) YPR104C_808	0.791	0.817
AGOS_AEL327W M01004_2.00	Ashbya gossypii	NNVRCKCRNN	NNYGMGYBNN	PBM Nakagawa et al.(2013) AEL327Wp	0.739	0.817
KLLA0_F08206g M01015_2.00	Kluyveromyces lactis	NNVRYKCRNN	NNYGMRYBNN	PBM Nakagawa et al.(2013) KLLA0F08206p	0.684	0.780
For this family, TFs with SR scores > 0.664* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CCH60049	Forkhead	952	1038	KPLISYSVLLTTCIRKYATPKGMSLSEIYNAIRETYPYYKYCRDGWQSSVRHNLSLNKSFRKVSKGGKGWLWGLDEDYITERDRQKK

Links
Other Forkhead family TFs
Other *Tetrapisispora blattae* TFs