CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

BGIOSGA020596 *(Oryza indica)* GATA
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00320 (GATA)	IPR000679	BGIOSGA020596	T191824_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
OS06G0698900 M02015_2.00	Oryza sativa	NNNNAHBNN	NNVDTNNNN	PBM Weirauch et al.(2014) pTH8641	0.865	0.917
GATA24 M01941_2.00	Arabidopsis thaliana	HGATBNN	NNVATCD	PBM Weirauch et al.(2014) pTH7661	0.856	0.806
GATA28 M01996_2.00	Arabidopsis thaliana	NNGATNN	NNATCNN	PBM Weirauch et al.(2014) pTH7505	0.850	0.806
GATA28 M06883_2.00	Arabidopsis thaliana	GATGATGATGATGATGATG	CATCATCATCATCATCATC	Dap-seq OMalley et al.(2016) ZML2_col_a	0.850	0.806
ZIM M06892_2.00	Arabidopsis thaliana	AWYSRACGGYYVWGA	TCWBRRCCGTYSRWT	Dap-seq OMalley et al.(2016) ZIM_col_a	0.809	0.750
For this family, TFs with SR scores > 0.802* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
BGIOSGA020596-PA	GATA	209	246	CHHCGINAKATPMMRRGPDGPRTLCNACGLMWANKVKM

Links
Other GATA family TFs
Other *Oryza indica* TFs