CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bo3g024250 *(Brassica oleracea)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	Bo3g024250	T253091_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FLC M06990_2.00	Arabidopsis thaliana	WWDMYNDWWWWGGAAASW	WSTTTCCWWWWHNRKHWW	Dap-seq OMalley et al.(2016) AGL25_col_a	0.896	0.896
FLC M06991_2.00	Arabidopsis thaliana	WCYHAAAAWGGAAAS	STTTCCWTTTTDRGW	Dap-seq OMalley et al.(2016) AGL25_colamp_a	0.896	0.896
FLC M08147_2.00	Arabidopsis thaliana	NNWWDCYVAAAWWRGAAAVHH	DDBTTTCYWWTTTBRGHWWNN	ChIP-seq Mathelier et al.(2014) MA0558.1	0.896	0.896
AGL27 M08145_2.00	Arabidopsis thaliana	MCMAAAATRGAAAB	VTTTCYATTTTKGK	ChIP-seq Mathelier et al.(2014) MA1012.1	0.729	0.729
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bo3g024250.1	MADS box	10	57	RIEENSSRQVTFCKRRNGLIEKARQLSVLCDASVGLLVVSASDKLYSF

Links
Other MADS box family TFs
Other *Brassica oleracea* TFs