CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

AMTR_s00025p00072580 *(Amborella trichopoda)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	AMTR_s00025p00072580	T266175_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ASR3 M07053_2.00	Arabidopsis thaliana	DNNNNHHWNDRCCCTWAW	WTWAGGGYHNWDDNNNNH	Dap-seq OMalley et al.(2016) AT2G33550_col_a	0.740	0.822
ASR3 M07054_2.00	Arabidopsis thaliana	NHWDDTRCCCTWMW	WKWAGGGYAHHWDN	Dap-seq OMalley et al.(2016) AT2G33550_colamp_a	0.740	0.822
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ERN12336	Myb	34	98	PRWTRQEIVVLIEGKRVEESRGRKYRVFDGGPANTESKWSSISSYCKRHGVNREPVQCRKRWSTL

Links
Other Myb/SANT family TFs
Other *Amborella trichopoda* TFs