CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

OSTLU_6612 *(Ostreococcus lucimarinus)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	OSTLU_6612	T277327_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RVE5 M01079_2.00	Arabidopsis thaliana	NWAATATCHN	NDGATATTWN	PBM Sullivan et al.(2014) pTH7138	0.741	0.674
RVE5 M07100_2.00	Arabidopsis thaliana	NNAAAATATCT	AGATATTTTNN	Dap-seq OMalley et al.(2016) At4g01280_col_a	0.741	0.674
RVE5 M07101_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) At4g01280_colamp_a	0.741	0.674
RVE8 M01074_2.00	Arabidopsis thaliana	NNNRWATCNN	NNGATWYNNN	PBM Sullivan et al.(2014) pTH7136	0.732	0.674
PK02532.1 M02347_2.00	Cannabis sativa	WAATATCTN	NAGATATTW	PBM Weirauch et al.(2014) pTH9579	0.732	0.674
RVE8 M07069_2.00	Arabidopsis thaliana	NHNWAAATATCT	AGATATTTWNDN	Dap-seq OMalley et al.(2016) At3g09600_col_a	0.732	0.674
RVE8 M07070_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) At3g09600_colamp_a	0.732	0.674
RVE4 M07117_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) LCL1_colamp_a	0.732	0.674
RVE4 M07118_2.00	Arabidopsis thaliana	NAAAATATCT	AGATATTTTN	Dap-seq OMalley et al.(2016) LCL1_col	0.732	0.674
RVE6 M01081_2.00	Arabidopsis thaliana	AATATCTD	HAGATATT	PBM Sullivan et al.(2014) pTH7151	0.722	0.652
RVE6 M07138_2.00	Arabidopsis thaliana	NNAAAATATCT	AGATATTTTNN	Dap-seq OMalley et al.(2016) At5g52660_col_a	0.722	0.652
RVE6 M07139_2.00	Arabidopsis thaliana	NNNWAAATATCT	AGATATTTWNNN	Dap-seq OMalley et al.(2016) At5g52660_colamp_a	0.722	0.652
mybG M02319_2.00	Dictyostelium discoideum	WAATATCT	AGATATTW	PBM Weirauch et al.(2014) pTH5362	0.719	0.674
OS08G0157600 M02330_2.00	Oryza sativa	DNRTATCHN	NDGATAYNH	PBM Weirauch et al.(2014) pTH7793	0.712	0.674
LHY M06997_2.00	Arabidopsis thaliana	NWAAATATCT	AGATATTTWN	Dap-seq OMalley et al.(2016) LHY1_col_a	0.702	0.652
LHY M06998_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) LHY1_colamp_a	0.702	0.652
PK08316.1 M02350_2.00	Cannabis sativa	NNNRWATCNN	NNGATWYNNN	PBM Weirauch et al.(2014) pTH9488	0.681	0.652
RVE7 M01069_2.00	Arabidopsis thaliana	NDHRWATCNN	NNGATWYDHN	PBM Sullivan et al.(2014) pTH7081	0.670	0.565
RVE7 M02286_2.00	Arabidopsis thaliana	NDARTATCH	DGATAYTHN	PBM Weirauch et al.(2014) pTH7277	0.670	0.565
RVE7L M07071_2.00	Arabidopsis thaliana	NNNNWAAATATCWNN	NNWGATATTTWNNNN	Dap-seq OMalley et al.(2016) AT3G10113_col_a	0.670	0.565
RVE7 M07008_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) EPR1_colamp_a	0.670	0.565
RVE7 M07009_2.00	Arabidopsis thaliana	NWAAATATCTHN	NDAGATATTTWN	Dap-seq OMalley et al.(2016) EPR1_col	0.670	0.565
RVE1 M00879_2.00	Arabidopsis thaliana	AAATATCT	AGATATTT	PBM Franco-Zorrilla et al.(2014) RVE1	0.668	0.652
RVE1 M07128_2.00	Arabidopsis thaliana	NNNWAAATATCTNN	NNAGATATTTWNNN	Dap-seq OMalley et al.(2016) RVE1_col_a	0.668	0.652
RVE1 M07129_2.00	Arabidopsis thaliana	NNWAATATCW	WGATATTWNN	Dap-seq OMalley et al.(2016) RVE1_colamp_a	0.668	0.652
CCA1 M00875_2.00	Arabidopsis thaliana	NDNRWATCN	NGATWYNHN	PBM Franco-Zorrilla et al.(2014) CCA1	0.666	0.609
CCA1 M11039_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CCA1_Q5	0.666	0.609
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ABO95903	Myb	13	58	RVSWTPKEHQRFLRALELYSRDWKRIEEYVGSKDVVQIRSHAQKHF

Links
Other Myb/SANT family TFs
Other *Ostreococcus lucimarinus* TFs

398 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
GRMZM2G096759	Zea mays	GRMZM2G096759	N
GRMZM2G130784	Zea mays	GRMZM2G130784	N
GRMZM5G884544	Zea mays	GRMZM5G884544	N
Pavir.Da01516	Panicum virgatum	Pavir.Da01516	N
Pavir.J20053	Panicum virgatum	Pavir.J20053	N
Sb09g021520	Sorghum bicolor	Sb09g021520	N
Si021654m.g	Setaria italica	Si021654m.g	N

OSTLU_6612 (Ostreococcus lucimarinus) Myb/SANT

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

398 Related TFs

OSTLU_6612 **(Ostreococcus lucimarinus)
Myb/SANT**