CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

SELMODRAFT_413266 *(Selaginella moellendorffii)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	SELMODRAFT_413266	T279535_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK06103.1 M02348_2.00	Cannabis sativa	TGCCCTAG	CTAGGGCA	PBM Weirauch et al.(2014) pTH9649	0.772	0.766
estExt_fgenesh1_pg.C_Chr_13.00010057 M02366_2.00	Ostreococcus tauri	NRMCCTANN	NNTAGGKYN	PBM Weirauch et al.(2014) pTH9424	0.747	0.787
TRB2 M02314_2.00	Arabidopsis thaliana	WRMCCTAR	YTAGGKYW	PBM Weirauch et al.(2014) pTH7094	0.719	0.766
TRB2 M01083_2.00	Arabidopsis thaliana	HRMCCTAR	YTAGGKYD	PBM Sullivan et al.(2014) pTH7260	0.719	0.766
TRB2 M07157_2.00	Arabidopsis thaliana	HHHHHNWWRCCCTAAWHHN	NDDWTTAGGGYWWNDDDDD	Dap-seq OMalley et al.(2016) TBP3_col_a	0.719	0.766
TRB2 M07158_2.00	Arabidopsis thaliana	HVDHHHNWARCCCTAAHYH	DRDTTAGGGYTWNDDDHBD	Dap-seq OMalley et al.(2016) TBP3_colamp_a	0.719	0.766
OS01G0708000 M02326_2.00	Oryza sativa	WRMCCTAVNN	NNBTAGGKYW	PBM Weirauch et al.(2014) pTH8716	0.687	0.809
TRB1 M01070_2.00	Arabidopsis thaliana	WRMCCTAR	YTAGGKYW	PBM Sullivan et al.(2014) pTH7117	0.673	0.723
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EFJ25936	Myb	5	57	KQKWTPEEEAALRAGVEKYGAGKWRAIQKDPKFGPVLKSRSNVDLKDKWRNLS

Links
Other Myb/SANT family TFs
Other *Selaginella moellendorffii* TFs