CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Cucsa.349620 *(Cucumis sativus)* SBP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03110 (SBP)	IPR004333	Cucsa.349620	T323268_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
SPL13A M07265_2.00	Arabidopsis thaliana	DNYGTACGGWH	DWCCGTACRNH	Dap-seq OMalley et al.(2016) SPL13_col_a	0.958	0.787
fgenesh1_pg.scaffold_252000020 M02481_2.00	Physcomitrella patens	NNNKRCVNN	NNBGYMNNN	PBM Weirauch et al.(2014) pTH8491	0.910	0.760
fgenesh1_pg.scaffold_194000034 M02480_2.00	Physcomitrella patens	NNNGTACNNN	NNNGTACNNN	PBM Weirauch et al.(2014) pTH8580	0.896	0.747
SPL1 M00887_2.00	Arabidopsis thaliana	NGTACGGHN	NDCCGTACN	PBM Franco-Zorrilla et al.(2014) SPL1	0.886	0.680
SPL1 M07259_2.00	Arabidopsis thaliana	NNNBGTACGGW	WCCGTACVNNN	Dap-seq OMalley et al.(2016) SPL1_col_a	0.886	0.680
SPL1 M07260_2.00	Arabidopsis thaliana	NNGTACGKWH	DWMCGTACNN	Dap-seq OMalley et al.(2016) SPL1_colamp_a	0.886	0.680
For this family, TFs with SR scores > 0.885* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cucsa.349620.1	SBP	50	124	CMVDGCSSDLSKCRDYHRRHKVCELHSKTPKVTICGQEQRFCQQCSRFHSLVEFDDRKRSCRKRLDGHNRRRRKP

Links
Other SBP family TFs
Other *Cucumis sativus* TFs