CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

AACERI_AaceriAEL005C *(Saccharomycetaceae sp ashbya aceri)* Sox
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00505 (HMG_box)	IPR000910	AACERI_AaceriAEL005C	T326242_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
NHP10 M00068_2.00	Saccharomyces cerevisiae	TCCCCGGC	GCCGGGGA	PBM Badis et al.(2008) NHP10_2069	0.417	0.588
NHP10 M07496_2.00	Saccharomyces cerevisiae	YCCCCGGY	RCCGGGGR	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0344.1	0.417	0.588
NHP10 M08604_2.00	Saccharomyces cerevisiae	TCCCCGGY	RCCGGGGA	Misc DeBoer et al.(2011) YDL002C_502	0.417	0.588
For this family, TFs with SR scores > 0.415* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AGO12352	Sox	97	164	PKRPTNAYLLFCEMNKEKIRHEHAANNVDMTKVLPEIWKNMDEEAKKPYYDLYNADRLRYQREMTAYS

Links
Other Sox family TFs
Other *Saccharomycetaceae sp ashbya aceri* TFs