CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Eucgr.G00943 *(Eucalyptus grandis)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Eucgr.G00943	T008189_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF13 M01615_2.00	Arabidopsis thaliana	VGCCGSCD	HGSCGGCB	PBM Weirauch et al.(2014) pTH7283	0.752	0.773
ERF13 M06612_2.00	Arabidopsis thaliana	NHDBMGCCGCCDYHD	HDRHGGCGGCKVHDN	Dap-seq OMalley et al.(2016) ERF13_colamp_a	0.752	0.773
ERF13 M06613_2.00	Arabidopsis thaliana	HDBMGCCGCCDYHDN	NHDRHGGCGGCKVHD	Dap-seq OMalley et al.(2016) ERF13_col_b	0.752	0.773
ERF1A M00848_2.00	Arabidopsis thaliana	NNNNRNN	NNYNNNN	PBM Franco-Zorrilla et al.(2014) ATERF1	0.695	0.705
ERF1A M00720_2.00	Arabidopsis thaliana	NMGCCRNCN	NGNYGGCKN	PBM Chang et al.(2013) pTH7202	0.695	0.705
ERF2 M01631_2.00	Arabidopsis thaliana	NNNGCCGNCN	NGNCGGCNNN	PBM Weirauch et al.(2014) pTH8113	0.686	0.705
ERF2 M06672_2.00	Arabidopsis thaliana	HHNHHNYHDYCGCCGCCRYND	HNRYGGCGGCGRHDRNDDNDD	Dap-seq OMalley et al.(2016) ERF2_col_a	0.686	0.705
ERF2 M06673_2.00	Arabidopsis thaliana	NNNNNNNHNNHDSMGCCGCCR	YGGCGGCKSHDNNDNNNNNNN	Dap-seq OMalley et al.(2016) ERF2_colamp_a	0.686	0.705
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Eucgr.G00943.1	AP2	59	106	VRRRPWGKYAAEIKDPKKSGARIWLGTYEMLEDAALAYNQAAFKMQGS

Links
Other AP2 family TFs
Other *Eucalyptus grandis* TFs