CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

SapurV1A.0282s0080 *(Salix purpurea)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	SapurV1A.0282s0080	T009752_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DREB1D M06678_2.00	Arabidopsis thaliana	NHBRCCGACRTNN	NNAYGTCGGYVDN	Dap-seq OMalley et al.(2016) CBF4_col_a	0.743	0.800
DREB1D M06679_2.00	Arabidopsis thaliana	HYRCCGACATND	HNATGTCGGYRD	Dap-seq OMalley et al.(2016) CBF4_colamp_a	0.743	0.800
DREB1F M00962_2.00	Arabidopsis thaliana	NRCCGACNN	NNGTCGGYN	PBM LehtiShiu et al.(2015) DDF1_Arabidopsis_thaliana	0.733	0.760
DREB1F M00840_2.00	Arabidopsis thaliana	NRYCGACNN	NNGTCGRYN	PBM Franco-Zorrilla et al.(2014) DDF1	0.733	0.760
DDF1 M00964_2.00	Arabidopsis lyrata	NRYCGACDY	RHGTCGRYN	PBM LehtiShiu et al.(2015) DDF1_Arabidopsis_lyrata	0.733	0.760
DREB1F M06564_2.00	Arabidopsis thaliana	NHNHYGYCGACATNN	NNATGTCGRCRDNDN	Dap-seq OMalley et al.(2016) DDF1_col_a	0.733	0.760
DREB1F M06565_2.00	Arabidopsis thaliana	HNDNNRYCGACAH	DTGTCGRYNNHND	Dap-seq OMalley et al.(2016) DDF1_colamp_a	0.733	0.760
DREB1F M09701_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1F_03	0.733	0.760
DREB1A M01624_2.00	Arabidopsis thaliana	NRCCGACNNN	NNNGTCGGYN	PBM Weirauch et al.(2014) pTH8163	0.717	0.760
DREB1A M01625_2.00	Arabidopsis thaliana	NNRCCGACNW	WNGTCGGYNN	PBM Weirauch et al.(2014) pTH9718	0.717	0.760
DREB1A M06641_2.00	Arabidopsis thaliana	HNYBRCCGACDWNN	NNWHGTCGGYVRND	Dap-seq OMalley et al.(2016) CBF3_col_a	0.717	0.760
DREB1A M06642_2.00	Arabidopsis thaliana	YBRCCGACATN	NATGTCGGYVR	Dap-seq OMalley et al.(2016) CBF3_colamp_a	0.717	0.760
ddf2 M00965_2.00	Arabidopsis lyrata	NRYCGACAT	ATGTCGRYN	PBM LehtiShiu et al.(2015) DDF2_Arabidopsis_lyrata	0.705	0.700
DREB1C M01623_2.00	Arabidopsis thaliana	RCCGACAT	ATGTCGGY	PBM Weirauch et al.(2014) pTH8187	0.704	0.740
DREB1C M06639_2.00	Arabidopsis thaliana	NNNHBRCCGACATNN	NNATGTCGGYVDNNN	Dap-seq OMalley et al.(2016) CBF2_col_a	0.704	0.740
DREB1C M06640_2.00	Arabidopsis thaliana	NYBRCCGACATVN	NBATGTCGGYVRN	Dap-seq OMalley et al.(2016) CBF2_colamp_a	0.704	0.740
DREB1G M01635_2.00	Oryza sativa	NYGCCGACAN	NTGTCGGCRN	PBM Weirauch et al.(2014) pTH8352	0.680	0.740
DREB1G M09707_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1G_01	0.680	0.740
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
SapurV1A.0282s0080.1.p	AP2	66	117	PVFRGTRKRNGNKWVCEMREPSKKSRIWLGTYPTPEMAARAHDVAALALRGK

Links
Other AP2 family TFs
Other *Salix purpurea* TFs

166 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
OSTLU_27423	Ostreococcus lucimarinus	OSTLU_27423	N
OSTLU_27497	Ostreococcus lucimarinus	OSTLU_27497	N
fgenesh1_pg.C_scaffold_4000063	Micromonas pusilla	fgenesh1_pg.C_scaffold_4000063	N
EuGene.0400010690	Micromonas sp RCC299	EuGene.0400010690	N

SapurV1A.0282s0080 (Salix purpurea) AP2

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

166 Related TFs

SapurV1A.0282s0080 **(Salix purpurea)
AP2**