CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

TriadG51792 *(Trichoplax adhaerens)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	TriadG51792	T045828_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MAX M00938_2.00	Homo sapiens	CCACGTGH	DCACGTGG	PBM Guo et al.(2014) Max_L	0.857	0.846
Max M00121_2.00	Mus musculus	NCRCRTGNN	NNCAYGYGN	PBM Badis et al.(2009) Max_3863	0.857	0.846
Max M00122_2.00	Mus musculus	NNCRCRTGN	NCAYGYGNN	PBM Badis et al.(2009) Max_3864	0.857	0.846
Max M01753_2.00	Mus musculus	NCAYGYKNN	NNMRCRTGN	PBM Weirauch et al.(2014) pTH4381	0.857	0.846
Max M08778_2.00	Mus musculus	VVVCACGYGSN	NSCRCGTGBBB	Misc Kulakovskiy et al.(2013) MAX_MOUSE.H11MO.0.A	0.857	0.846
Max M03612_2.00	Drosophila melanogaster	VRAMCACGTGBTYB	VRAVCACGTGKTYB	SELEX Nitta et al.(2015) Max_1	0.839	0.731
Max M05969_2.00	Drosophila melanogaster	HCCACGTGBY	RVCACGTGGD	B1H Zhu et al.(2011) dm_Max_SANGER_10_FBgn0017578	0.839	0.731
Max M05970_2.00	Drosophila melanogaster	CCACGTG	CACGTGG	B1H Zhu et al.(2011) Max_Mnt_SANGER_5_FBgn0017578	0.839	0.731
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
TriadP51792	bHLH	32	83	KRAHHNALERKRRDHIKDCFFGLRDSVPTLQGEKASRAQILNKATDYIQFMK

Links
Other bHLH family TFs
Other *Trichoplax adhaerens* TFs