CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Ciclev10004273m.g *(Citrus clementina)* CG-1
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03859 (CG-1)	IPR005559	Ciclev10004273m.g	T163509_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
CAMTA5 M06827_2.00	Arabidopsis thaliana	NVGYGTNNDHNVCGYGTN	NACRCGBNDHNNACRCBN	Dap-seq OMalley et al.(2016) CAMTA5_col_a	0.895	0.895
Q2WEL1_ORYSA M10406_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBT_01	0.737	0.737
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Ciclev10004273m	CG-1	27	141	EAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRET

Links
Other CG-1 family TFs
Other *Citrus clementina* TFs