CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSOARG00000012916 *(Ovis aries)* EBF1
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF16422 (COE1_DBD)	(none)	ENSOARG00000012916	T174628_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Ebf1 M09045_2.00	Mus musculus	DBYCCCWRGGGAV	BTCCCYWGGGRVH	Misc Kulakovskiy et al.(2013) COE1_MOUSE.H11MO.0.A	1.000	1.000
Ebf1 M09527_2.00	Mus musculus	DBTCCCHDGGGA	TCCCHDGGGAVH	Misc Heinz et al.(2010) proBcell-EBF_GSE21978	1.000	1.000
Ebf1 M10469_2.00	Mus musculus	VYMHVYYCYYBRGGGAVTHKHB	VDMDABTCCCYVRRGRRBDKRB	Transfac Matys et al.(2006) V$OLF1_01	1.000	1.000
EBF3 M10461_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF_Q6	0.935	0.935
EBF4 M10460_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF4_02	0.840	0.840
Ebf4 M10468_2.00	Mus musculus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF4_01	0.834	0.834
Ebf2 M10467_2.00	Mus musculus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$COE2_01	0.811	0.811
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSOARP00000013832	EBF1	24	192	EEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR

Links
Other EBF1 family TFs
Other *Ovis aries* TFs