CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

est_orfs.8_8223_4279363:1 *(Micromonas pusilla)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	est_orfs.8_8223_4279363:1	T284835_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RVE8 M01074_2.00	Arabidopsis thaliana	NNNRWATCNN	NNGATWYNNN	PBM Sullivan et al.(2014) pTH7136	0.723	0.783
PK02532.1 M02347_2.00	Cannabis sativa	WAATATCTN	NAGATATTW	PBM Weirauch et al.(2014) pTH9579	0.723	0.783
RVE8 M07069_2.00	Arabidopsis thaliana	NHNWAAATATCT	AGATATTTWNDN	Dap-seq OMalley et al.(2016) At3g09600_col_a	0.723	0.783
RVE8 M07070_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) At3g09600_colamp_a	0.723	0.783
RVE4 M07117_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) LCL1_colamp_a	0.723	0.783
RVE4 M07118_2.00	Arabidopsis thaliana	NAAAATATCT	AGATATTTTN	Dap-seq OMalley et al.(2016) LCL1_col	0.723	0.783
RVE6 M01081_2.00	Arabidopsis thaliana	AATATCTD	HAGATATT	PBM Sullivan et al.(2014) pTH7151	0.713	0.761
RVE6 M07138_2.00	Arabidopsis thaliana	NNAAAATATCT	AGATATTTTNN	Dap-seq OMalley et al.(2016) At5g52660_col_a	0.713	0.761
RVE6 M07139_2.00	Arabidopsis thaliana	NNNWAAATATCT	AGATATTTWNNN	Dap-seq OMalley et al.(2016) At5g52660_colamp_a	0.713	0.761
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
est_orfs.8_8223_4279363:1	Myb	18	63	RESWTEKEHNMFLEAINMYDRDWKKIETYVGTKTVIQIRSHAQKYF

Links
Other Myb/SANT family TFs
Other *Micromonas pusilla* TFs

215 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
Traes_1AL_6A75A61AC	Triticum aestivum	Traes_1AL_6A75A61AC	N
Traes_1BL_119609AE8	Triticum aestivum	Traes_1BL_119609AE8	N
TRIUR3_01735	Triticum urartu	TRIUR3_01735	N
TRIUR3_06411	Triticum urartu	TRIUR3_06411	N
TRIUR3_26254	Triticum urartu	TRIUR3_26254	N
TRIUR3_26255	Triticum urartu	TRIUR3_26255	N